ATPBD4 Monoclonal antibody, PBS Only

• 

  WB analysis using 68397-1-Ig (same clone as 68397-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68397-1-Ig (ATPBD4 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Alpha Tubulin Monoclonal antibody (HRP-66031) as loading control. This data was developed using the same antibody clone with 68397-1-PBS in a different storage buffer formulation.

• 

  WB analysis of K-562 using 68397-1-Ig (same clone as 68397-1-PBS)

  K-562 cells were subjected to SDS PAGE followed by western blot with 68397-1-Ig (ATPBD4 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68397-1-PBS in a different storage buffer formulation.

ATPBD4 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 68397-1-PBS

Clone No.2B12E1

Host / Isotype

Mouse / IgG1

Reactivity

Human

Applications

WB, Indirect ELISA

Synonyms

ATP binding domain 4, ATPBD4, DPH6

---

Product Information

68397-1-PBS targets ATPBD4 in WB, Indirect ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag33218

  Product name: Recombinant human ATPBD4 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-259 aa of BC008485

  Sequence: GGKDSCYNMMQCIAAGHQIVALANLRPAENQVGSDELDSYMYQTVGHHAIDLYAEAMALPLYRRTIRGRSLDTRQVYTKCEGDEVEDLYELLKLVKEKEEVEGISVGAILSDYQRIRVENVCKRLNLQPLAYLWQRNQEDLLREMISSNIQAMIIKVAALGLDPDKHLGKTLDQMEPYLIELSKKYGVHVCGEGGEYETFTLDCPLFKKKIIVDSSEVVIHSADAFAPVAYLRFLELHLEDKVSSVPDNYRTSNYIYNF

• Full Name: ATP binding domain 4
• Calculated Molecular Weight: 267 aa, 30 kDa
• Observed Molecular Weight: 28-30 kDa
• GenBank Accession Number: BC008485
• Gene Symbol: ATPBD4
• Gene ID (NCBI): 89978
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q7L8W6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Diphthamide is a highly modified histidine in the transcription factor EEF2 that is conserved from yeast to human. ATPBD4, also known as DPH6, belongs to the Diphthine--ammonia ligase family. DPH6 amidase may catalyze the last step of diphthamide biosynthesis using ammonium and ATP to play a role in catalyzing the final step of diphthamide biosynthesis, amidation of diphthine to diphthamide (PubMed:23169644).