Published Applications
WB | See 1 publications below |
ELISA | See 1 publications below |
Product Information
14061-1-AP targets ATRIP in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag5102 Product name: Recombinant human ATRIP protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 401-498 aa of BC030597 Sequence: SLLLSGVGADSAAGEGNRSLVHRLSDGDMTSALRGVADDQGQHPLLKMLLHLLAFSSAATGHLQASVLTQCLKVLVKLAENTSCDFLPRFQCVFQVLP Predict reactive species |
Full Name | ATR interacting protein |
Calculated Molecular Weight | 86 kDa |
GenBank Accession Number | BC030597 |
Gene Symbol | ATRIP |
Gene ID (NCBI) | 84126 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q8WXE1 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |