Published Applications
| WB | See 1 publications below |
| ELISA | See 1 publications below |
Product Information
14061-1-AP targets ATRIP in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5102 Product name: Recombinant human ATRIP protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 401-498 aa of BC030597 Sequence: SLLLSGVGADSAAGEGNRSLVHRLSDGDMTSALRGVADDQGQHPLLKMLLHLLAFSSAATGHLQASVLTQCLKVLVKLAENTSCDFLPRFQCVFQVLP Predict reactive species |
| Full Name | ATR interacting protein |
| Calculated Molecular Weight | 86 kDa |
| GenBank Accession Number | BC030597 |
| Gene Symbol | ATRIP |
| Gene ID (NCBI) | 84126 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8WXE1 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
