Product Information
21689-1-AP targets ATRNL1 in WB, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag16270 Product name: Recombinant human ATRNL1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 247-356 aa of BC139916 Sequence: PYCKANCGSPDHGYCDLTGEKLCVCNDSWQGPDCSLNVPSTESYWILPNVKPFSPSVGRASHKAVLHGKFMWVIGGYTFNYSSFQMVLNYNLESSIWNVGTPSRGPLQRY Predict reactive species |
Full Name | attractin-like 1 |
Calculated Molecular Weight | 1379 aa, 153 kDa |
GenBank Accession Number | BC139916 |
Gene Symbol | ATRNL1 |
Gene ID (NCBI) | 26033 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q5VV63 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |