Product Information
20495-1-PBS targets ATRX in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag13984 Product name: Recombinant human ATRX protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-87 aa of BC002521 Sequence: MTAEPMSESKLNTLVQKLHDFLAHSSEESEETSSPPRLAMNQNTDKISGSGSNSDMMENSKEEGTSSSEKSKSSGSSRSKRKPSIVN Predict reactive species |
| Full Name | alpha thalassemia/mental retardation syndrome X-linked (RAD54 homolog, S. cerevisiae) |
| Calculated Molecular Weight | 2492 aa, 283 kDa |
| Observed Molecular Weight | 280-300 kDa |
| GenBank Accession Number | BC002521 |
| Gene Symbol | ATRX |
| Gene ID (NCBI) | 546 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P46100 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
The α-thalassemia mental retardation X-linked protein (ATRX) is a member of the Switch 2, sucrose non-fermenting 2 (SWI2/SNF2) family of helicases/ATPases that exhibits chromatin remodeling activity. ATRX contains an atypical plant homeodomain (PHD) finger domain that recognizes a combinatorial modification pattern on histone H3 tails. ATRX mutations in cancer are most commonly found in pediatric and adolescent malignancies including glioma, neuroblastoma, adrenocortical carcinoma and osteosarcoma(PMID: 32015155).









