Tested Applications
| Positive WB detected in | A549 cells |
| Positive IHC detected in | rat brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A549 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:1000-1:4000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
20495-1-AP targets ATRX in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag13984 Product name: Recombinant human ATRX protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-87 aa of BC002521 Sequence: MTAEPMSESKLNTLVQKLHDFLAHSSEESEETSSPPRLAMNQNTDKISGSGSNSDMMENSKEEGTSSSEKSKSSGSSRSKRKPSIVN Predict reactive species |
| Full Name | alpha thalassemia/mental retardation syndrome X-linked (RAD54 homolog, S. cerevisiae) |
| Calculated Molecular Weight | 2492 aa, 283 kDa |
| Observed Molecular Weight | 280-300 kDa |
| GenBank Accession Number | BC002521 |
| Gene Symbol | ATRX |
| Gene ID (NCBI) | 546 |
| RRID | AB_3085606 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P46100 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The α-thalassemia mental retardation X-linked protein (ATRX) is a member of the Switch 2, sucrose non-fermenting 2 (SWI2/SNF2) family of helicases/ATPases that exhibits chromatin remodeling activity. ATRX contains an atypical plant homeodomain (PHD) finger domain that recognizes a combinatorial modification pattern on histone H3 tails. ATRX mutations in cancer are most commonly found in pediatric and adolescent malignancies including glioma, neuroblastoma, adrenocortical carcinoma and osteosarcoma(PMID: 32015155).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for ATRX antibody 20495-1-AP | Download protocol |
| IHC protocol for ATRX antibody 20495-1-AP | Download protocol |
| WB protocol for ATRX antibody 20495-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Reviews
What customers say
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Roy (Verified Customer) (06-13-2024) | Works great to detect ATRX in Jurkat/HeLa cells by WB (1/1000 dilution- Overnight incubation at 4°C).
|









