ATRX Polyclonal antibody

• 

  WB analysis using 20495-1-AP

  A549 cells were subjected to Tris-Acetate gel system followed by western blot with 20495-1-AP (ATRX antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  IHC staining of rat brain using 20495-1-AP

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 20495-1-AP (ATRX antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat brain using 20495-1-AP

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 20495-1-AP (ATRX antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of A549 using 20495-1-AP

  Immunofluorescent analysis of (4% PFA) fixed A549 cells using ATRX antibody (20495-1-AP) at dilution of 1:2000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red).

• 

  IF Staining of A549 using 20495-1-AP

  Immunofluorescent analysis of (4% PFA) fixed A549 cells using ATRX antibody (20495-1-AP) at dilution of 1:3000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red).

ATRX Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 20495-1-AP

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

RAD54L, RAD54, MRXHF1, EC:3.6.4.12, ATR2

---

Tested Applications

• Positive WB detected in: A549 cells
• Positive IHC detected in: rat brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

20495-1-AP targets ATRX in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13984

  Product name: Recombinant human ATRX protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-87 aa of BC002521

  Sequence: MTAEPMSESKLNTLVQKLHDFLAHSSEESEETSSPPRLAMNQNTDKISGSGSNSDMMENSKEEGTSSSEKSKSSGSSRSKRKPSIVN

• Full Name: alpha thalassemia/mental retardation syndrome X-linked (RAD54 homolog, S. cerevisiae)
• Calculated Molecular Weight: 2492 aa, 283 kDa
• Observed Molecular Weight: 280-300 kDa
• GenBank Accession Number: BC002521
• Gene Symbol: ATRX
• Gene ID (NCBI): 546
• RRID: AB_3085606
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P46100
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The α-thalassemia mental retardation X-linked protein (ATRX) is a member of the Switch 2, sucrose non-fermenting 2 (SWI2/SNF2) family of helicases/ATPases that exhibits chromatin remodeling activity. ATRX contains an atypical plant homeodomain (PHD) finger domain that recognizes a combinatorial modification pattern on histone H3 tails. ATRX mutations in cancer are most commonly found in pediatric and adolescent malignancies including glioma, neuroblastoma, adrenocortical carcinoma and osteosarcoma(PMID: 32015155).

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Roy (Verified Customer) (06-13-2024)

Works great to detect ATRX in Jurkat/HeLa cells by WB (1/1000 dilution- Overnight incubation at 4°C).

• Applications: Western Blot
• Primary Antibody Dilution: 1/1000
• Cell Tissue Type: HeLa/Jurkat cells