Tested Applications
| Positive WB detected in | A549 cells |
| Positive IHC detected in | rat brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A549 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:1000-1:4000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
20495-1-AP targets ATRX in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag13984 Product name: Recombinant human ATRX protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-87 aa of BC002521 Sequence: MTAEPMSESKLNTLVQKLHDFLAHSSEESEETSSPPRLAMNQNTDKISGSGSNSDMMENSKEEGTSSSEKSKSSGSSRSKRKPSIVN Predict reactive species |
| Full Name | alpha thalassemia/mental retardation syndrome X-linked (RAD54 homolog, S. cerevisiae) |
| Calculated Molecular Weight | 2492 aa, 283 kDa |
| Observed Molecular Weight | 280-300 kDa |
| GenBank Accession Number | BC002521 |
| Gene Symbol | ATRX |
| Gene ID (NCBI) | 546 |
| RRID | AB_3085606 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P46100 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The α-thalassemia mental retardation X-linked protein (ATRX) is a member of the Switch 2, sucrose non-fermenting 2 (SWI2/SNF2) family of helicases/ATPases that exhibits chromatin remodeling activity. ATRX contains an atypical plant homeodomain (PHD) finger domain that recognizes a combinatorial modification pattern on histone H3 tails. ATRX mutations in cancer are most commonly found in pediatric and adolescent malignancies including glioma, neuroblastoma, adrenocortical carcinoma and osteosarcoma(PMID: 32015155).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for ATRX antibody 20495-1-AP | Download protocol |
| IHC protocol for ATRX antibody 20495-1-AP | Download protocol |
| WB protocol for ATRX antibody 20495-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Reviews
What customers say
One reviewer (Roy Matkovic, June 2024) gave a 5-star rating for Western Blot using lot 00013036 at a 1/1000 dilution with overnight incubation at 4°C on HeLa and Jurkat cells. They reported the antibody works great for detecting ATRX, with no issues noted. Overall, the single review reflects strong satisfaction with the product's performance in WB applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Roy (Verified Customer) (06-13-2024) | Works great to detect ATRX in Jurkat/HeLa cells by WB (1/1000 dilution- Overnight incubation at 4°C).
|
