AVPI1 Polyclonal antibody, PBS Only

• 

  IHC staining of human lung cancer using 12005-1-AP (same clone as 12005-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 12005-1-AP (AVPI1 Antibody) at dilution of 1:100 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12005-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 12005-1-AP (same clone as 12005-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 12005-1-AP (AVPI1 Antibody) at dilution of 1:100 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12005-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 12005-1-AP (same clone as 12005-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 12005-1-AP (AVPI1 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12005-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 12005-1-AP (same clone as 12005-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 12005-1-AP (AVPI1 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12005-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 12005-1-AP (same clone as 12005-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer using 12005-1-AP (AVPI1 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 12005-1-PBS in a different storage buffer formulation.

AVPI1 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 12005-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, Indirect ELISA

Synonyms

Arginine vasopressin-induced protein 1, AVP induced protein 1, AVP-induced protein 1, NPD013, PP5395

---

Product Information

12005-1-PBS targets AVPI1 in IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2626

  Product name: Recombinant human AVPI1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-147 aa of BC000877

  Sequence: MGTPASVVSEPPPWQAPIEARGRKQASANIFQDAELLQIQGLFQRSGDQLAEERAQIIWECAGDHRVAEALKRLRRKRPPRQKPLGHSLHHCSRLRILEPHSALANPQSATETASSEQYLHSRKKSARIRRNWRKSGPTSYLHQIRH

• Full Name: arginine vasopressin-induced 1
• Calculated Molecular Weight: 21.5 kDa
• GenBank Accession Number: BC000877
• Gene Symbol: AVPI1
• Gene ID (NCBI): 60370
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5T686
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

AVPI1, also named as NPD013 and PP5395, is an arginine vasopressin-induced protein. It may be involved in MAP kinase activation, epithelial sodium channel (ENaC) down-regulation and cell cycling.