Adenosine A1 Receptor Polyclonal antibody, PBS Only

• 

  WB analysis using 20332-1-AP (same clone as 20332-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 20332-1-AP (Adenosine A1 Receptor antibody) at dilution of 1:15000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20332-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 20332-1-AP (same clone as 20332-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 20332-1-AP (Adenosine A1 Receptor antibody at dilution of 1:100 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20332-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 20332-1-AP (same clone as 20332-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 20332-1-AP (Adenosine A1 Receptor antibody at dilution of 1:100 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20332-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 20332-1-AP (same clone as 20332-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 20332-1-AP (Adenosine A1 Receptor antibody at dilution of 1:100 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20332-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 20332-1-AP (same clone as 20332-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 20332-1-AP (Adenosine A1 Receptor antibody at dilution of 1:100 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20332-1-PBS in a different storage buffer formulation.

• 

  FC experiment of SH-SY5Y using 20332-1-AP (same clone as 20332-1-PBS)

  1x10^6 SH-SY5Y cells were intracellularly stained with 0.4 ug Adenosine A1 Receptor Polyclonal antibody (20332-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.4 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 20332-1-PBS in a different storage buffer formulation.

Adenosine A1 Receptor Polyclonal Antibody for WB, IHC, FC (Intra), Indirect ELISA

Cat No. 20332-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, FC (Intra), Indirect ELISA

Synonyms

Adenosine receptor A1, ADORA1, RDC7

---

Product Information

20332-1-PBS targets Adenosine A1 Receptor in WB, IHC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14092

  Product name: Recombinant human ADORA1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 184-243 aa of BC026340

  Sequence: NFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALILFLF

• Full Name: adenosine A1 receptor
• Calculated Molecular Weight: 326 aa, 37 kDa
• Observed Molecular Weight: 40 and 45 kDa
• GenBank Accession Number: BC026340
• Gene Symbol: Adenosine A1 Receptor
• Gene ID (NCBI): 134
• RRID: AB_2878673
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P30542
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ADORA1, also named as RDC7, is a receptor for adenosine. It is mediated by G proteins which inhibit adenylyl cyclase. Adenosine is an important mediator of ethanol intoxication and exerts some of its effects via ADORA1 in the central nervous system.