Adenosine A1 Receptor Polyclonal antibody

Adenosine A1 Receptor Polyclonal Antibody for WB, IHC, FC (Intra), ELISA
Cat No. 20332-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF, FC (Intra), ELISA

Adenosine receptor A1, ADORA1, RDC7

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse eye tissue
Positive IHC detected inmouse brain tissue, mouse cerebellum tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inSH-SY5Y cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

20332-1-AP targets Adenosine A1 Receptor in WB, IHC, IF, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag14092

Product name: Recombinant human ADORA1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 184-243 aa of BC026340

Sequence: NFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALILFLF

Predict reactive species
Full Name adenosine A1 receptor
Calculated Molecular Weight 326 aa, 37 kDa
Observed Molecular Weight 39 kDa
GenBank Accession NumberBC026340
Gene Symbol Adenosine A1 Receptor
Gene ID (NCBI) 134
RRIDAB_2878673
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP30542
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ADORA1, also named as RDC7, is a receptor for adenosine. It is mediated by G proteins which inhibit adenylyl cyclase. Adenosine is an important mediator of ethanol intoxication and exerts some of its effects via ADORA1 in the central nervous system.

Protocols

Product Specific Protocols
IHC protocol for Adenosine A1 Receptor antibody 20332-1-APDownload protocol
WB protocol for Adenosine A1 Receptor antibody 20332-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseIHC

Cell Biol Toxicol

Adenosine kinase protects against acetaminophen-induced acute liver injury by activating autophagy in hepatocytes

Authors - Chuanxin Zhang
humanFC (Intra)

PLoS One

Discovery of a potent, selective, and tumor-suppressing antibody antagonist of adenosine A2A receptor

Authors - Linya Wang
mouseWB,IF

J Orthop Translat

CD73 alleviates osteoarthritis by maintaining anabolism and suppressing catabolism of chondrocytes extracellular matrix

Authors - Hu Guo
humanWB

Am J Physiol Cell Physiol

Abnormal purine metabolism in nasal epithelial cells affects allergic rhinitis by regulating Th17/Treg cells

Authors - Ting Xu
Loading...
||
New chat Able
正在加载,请稍候...