Tested Applications
Positive WB detected in | mouse eye tissue |
Positive IHC detected in | mouse brain tissue, mouse cerebellum tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive FC (Intra) detected in | SH-SY5Y cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 2 publications below |
IHC | See 1 publications below |
IF | See 1 publications below |
Product Information
20332-1-AP targets Adenosine A1 Receptor in WB, IHC, IF, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag14092 Product name: Recombinant human ADORA1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 184-243 aa of BC026340 Sequence: NFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALILFLF Predict reactive species |
Full Name | adenosine A1 receptor |
Calculated Molecular Weight | 326 aa, 37 kDa |
Observed Molecular Weight | 39 kDa |
GenBank Accession Number | BC026340 |
Gene Symbol | Adenosine A1 Receptor |
Gene ID (NCBI) | 134 |
RRID | AB_2878673 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P30542 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ADORA1, also named as RDC7, is a receptor for adenosine. It is mediated by G proteins which inhibit adenylyl cyclase. Adenosine is an important mediator of ethanol intoxication and exerts some of its effects via ADORA1 in the central nervous system.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for Adenosine A1 Receptor antibody 20332-1-AP | Download protocol |
IHC protocol for Adenosine A1 Receptor antibody 20332-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Cell Biol Toxicol Adenosine kinase protects against acetaminophen-induced acute liver injury by activating autophagy in hepatocytes | ||
PLoS One Discovery of a potent, selective, and tumor-suppressing antibody antagonist of adenosine A2A receptor | ||
J Orthop Translat CD73 alleviates osteoarthritis by maintaining anabolism and suppressing catabolism of chondrocytes extracellular matrix | ||
Am J Physiol Cell Physiol Abnormal purine metabolism in nasal epithelial cells affects allergic rhinitis by regulating Th17/Treg cells |