AgBR1 Monoclonal antibody

• 

  WB analysis of Recombinant protein using 67743-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67743-1-Ig at dilution of 1:160000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Recombinant protein using 67743-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67743-1-Ig at dilution of 1:80000 incubated at room temperature for 1.5 hours.

AgBR1 Monoclonal Antibody for WB, ELISA

Cat No. 67743-1-Ig

Clone No.2D1F10

Host / Isotype

Mouse / IgG1

Reactivity

Mosquito

Applications

WB, ELISA

Synonyms

A. aegypti bacteria-responsive protein 1, AgBR1, mosquito salivary protein

---

Tested Applications

• Positive WB detected in: Ag30168

Recommended dilution

• Western Blot (WB): WB : 1:20000-1:100000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67743-1-Ig targets AgBR1 in WB, ELISA applications and shows reactivity with Mosquito samples.

• Tested Reactivity: Mosquito
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30168

  Product name: Recombinant mosquito AgBR1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 240-365 aa of XM_001844620

  Sequence: AFLLKDSVEYVHLAAFDQKTPERNPSEADYTSPLYEPTGDGERIAANNVDAEVRYWLTNKTPPNKIVVGIASYGRGWKLPEDSGPVPPVTVDGPSPAGPYTNESGRYSYAEICTQLPGSRLSTLDG

• Full Name: AgBR1
• Calculated Molecular Weight: 49 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: XM_001844620
• Gene Symbol: AgBR1
• Gene ID (NCBI): 6034353
• RRID: AB_2918512
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: B0W7I8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

AgBR1, a mosquito salivary protein also known as A. aegypti bacteria-responsive protein 1, is found to induce inflammatory responses at the bite site (PMID: 32218189). Various studies suggest that AgBR1 plays a role in transmitting or facilitating infections of several viruses via Aedes aegypti mosquitoes (PMID: 30858571, 31312526).