Product Information
67743-1-PBS targets AgBR1 as part of a matched antibody pair:
MP50131-1: 67743-2-PBS capture and 67743-1-PBS detection (validated in Cytometric bead array, Sandwich ELISA)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
Tested Reactivity | Mosquito |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag30168 Product name: Recombinant mosquito AgBR1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 240-365 aa of XM_001844620 Sequence: AFLLKDSVEYVHLAAFDQKTPERNPSEADYTSPLYEPTGDGERIAANNVDAEVRYWLTNKTPPNKIVVGIASYGRGWKLPEDSGPVPPVTVDGPSPAGPYTNESGRYSYAEICTQLPGSRLSTLDG Predict reactive species |
Full Name | AgBR1 |
Calculated Molecular Weight | 49 kDa |
Observed Molecular Weight | 40 kDa |
GenBank Accession Number | XM_001844620 |
Gene Symbol | AgBR1 |
Gene ID (NCBI) | 6034353 |
RRID | AB_2918512 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein G purification |
UNIPROT ID | B0W7I8 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |
Background Information
AgBR1, a mosquito salivary protein also known as A. aegypti bacteria-responsive protein 1, is found to induce inflammatory responses at the bite site (PMID: 32218189). Various studies suggest that AgBR1 plays a role in transmitting or facilitating infections of several viruses via Aedes aegypti mosquitoes (PMID: 30858571, 31312526).