Mosquito AgBR1 Monoclonal antibody, PBS Only (Detector)

• 

  WB analysis of Recombinant protein using 67743-1-Ig (same clone as 67743-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67743-1-Ig at dilution of 1:160000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67743-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Recombinant protein using 67743-1-Ig (same clone as 67743-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67743-1-Ig at dilution of 1:80000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67743-1-PBS in a different storage buffer formulation.

• 

  Cytometric bead array standard curve of MP50131-1

  Cytometric bead array standard curve of MP50131-1, Mosquito AgBR1 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 67743-2-PBS. Detection antibody: 67743-1-PBS. Standard:Ag30168. Range: 1.563-100 ng/mL

AgBR1 Monoclonal Antibody for WB, Indirect ELISA, Cytometric bead array

Cat No. 67743-1-PBS

Clone No.2D1F10

Host / Isotype

Mouse / IgG1

Reactivity

Mosquito

Applications

WB, Indirect ELISA, Cytometric bead array

Synonyms

A. aegypti bacteria-responsive protein 1, AgBR1, mosquito salivary protein

---

Product Information

67743-1-PBS targets AgBR1 as part of a matched antibody pair:

MP50131-1: 67743-2-PBS capture and 67743-1-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: Mosquito
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30168

  Product name: Recombinant mosquito AgBR1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 240-365 aa of XM_001844620

  Sequence: AFLLKDSVEYVHLAAFDQKTPERNPSEADYTSPLYEPTGDGERIAANNVDAEVRYWLTNKTPPNKIVVGIASYGRGWKLPEDSGPVPPVTVDGPSPAGPYTNESGRYSYAEICTQLPGSRLSTLDG

• Full Name: AgBR1
• Calculated Molecular Weight: 49 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: XM_001844620
• Gene Symbol: AgBR1
• Gene ID (NCBI): 6034353
• RRID: AB_2918512
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: B0W7I8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

AgBR1, a mosquito salivary protein also known as A. aegypti bacteria-responsive protein 1, is found to induce inflammatory responses at the bite site (PMID: 32218189). Various studies suggest that AgBR1 plays a role in transmitting or facilitating infections of several viruses via Aedes aegypti mosquitoes (PMID: 30858571, 31312526).