Alpha-1-microglobulin Recombinant monoclonal antibody, PBS Only (Capture)

• 

  Sandwich ELISA standard curve of MP00658-2

  Sandwich ELISA standard curve of MP00658-2, Human Alpha-1-microglobulin Recombinant Matched Antibody Pair - PBS only. 83678-2-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Eg1127. 83678-4-PBS was HRP conjugated as the detection antibody. Range: 0.31-20 ng/mL.

• 

  Sample test of MP00658-2

  Serum of sixteen individual healthy human donors was measured. The Alpha-1-microglobulin concentration of detected samples was determined to be 5,141.28 ng/mL with a range of 3,368.97 - 9,130.33 ng/mL.

• 

  Sample test of MP00658-2

  Urine of eight individual healthy human donors was measured. The Alpha-1-microglobulin concentration of detected samples was determined to be 1,137.8 ng/mL with a range of 377.6 - 2,533.2 ng/mL.

Alpha-1-microglobulin Uni-rAb^® Recombinant Antibody for Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 83678-2-PBS

Clone No.240751G12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

AMBP, A1M, Alpha 1 microglobulin, Alpha 1 microglycoprotein, Alpha 1-microglobulin

---

Product Information

83678-2-PBS targets Alpha-1-microglobulin as part of a matched antibody pair:

MP00658-2: 83678-2-PBS capture and 83678-4-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1127

  Product name: Recombinant Human Alpha-1-microglobulin protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 20-203 aa of NM_001633.4

  Sequence: GPVPTPPDNIQVQENFNISRIYGKWYNLAIGSTCPWLKKIMDRMTVSTLVLGEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWNITMESYVVHTNYDEYAIFLTKKFSRHHGPTITAKLYGRAPQLRETLLQDFRVVAQGVGIPEDSIFTMADRGECVPGEQEPEPILIPRV

• Full Name: alpha-1-microglobulin/bikunin precursor
• Calculated Molecular Weight: 39kDa
• GenBank Accession Number: NM_001633.4
• Gene Symbol: Alpha 1 microglobulin
• Gene ID (NCBI): 259
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P02760
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.