Alpha cardiac muscle actin Polyclonal antibody, PBS Only

• 

  WB analysis of mouse heart using 11032-1-AP (same clone as 11032-1-PBS)

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 11032-1-AP (alpha Actin antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11032-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse heart using 11032-1-AP (same clone as 11032-1-PBS)

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 11032-1-AP (alpha Actin antibody at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11032-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse skeletal muscle using 11032-1-AP (same clone as 11032-1-PBS)

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 11032-1-AP (alpha Actin antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11032-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse thymus using 11032-1-AP (same clone as 11032-1-PBS)

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 11032-1-AP (alpha Actin antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11032-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse heart using 11032-1-AP (same clone as 11032-1-PBS)

  IP result of anti-Alpha Actin (IP:11032-1-AP, 4ug; Detection:11032-1-AP 1:800) with mouse heart tissue lysate 3200ug. This data was developed using the same antibody clone with 11032-1-PBS in a different storage buffer formulation.

Alpha cardiac muscle actin Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 11032-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, Indirect ELISA

Synonyms

ACTC1, Alpha actin, ACTC, ACTC 1, ACTC1 cardiac muscle 1

---

Product Information

11032-1-PBS targets Alpha cardiac muscle actin in WB, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1471

  Product name: Recombinant human ACTC1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-377 aa of BC009978

  Sequence: MCDDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF

• Full Name: actin, alpha, cardiac muscle 1
• Calculated Molecular Weight: 377 aa, 42 kDa
• Observed Molecular Weight: 42 kDa
• GenBank Accession Number: BC009978
• Gene Symbol: ACTC1
• Gene ID (NCBI): 70
• RRID: AB_2242376
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P68032
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.