Alpha cardiac muscle actin Polyclonal antibody

• 

  WB analysis of mouse heart using 11032-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 11032-1-AP (alpha Actin antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse thymus using 11032-1-AP

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 11032-1-AP (alpha Actin antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse skeletal muscle using 11032-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 11032-1-AP (alpha Actin antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse heart using 11032-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 11032-1-AP (alpha Actin antibody at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse heart using 11032-1-AP

  IP result of anti-Alpha Actin (IP:11032-1-AP, 4ug; Detection:11032-1-AP 1:800) with mouse heart tissue lysate 3200ug.

Alpha cardiac muscle actin Polyclonal Antibody for WB, IP, ELISA

Cat No. 11032-1-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, ELISA

Synonyms

ACTC1, Alpha actin, ACTC, ACTC 1, ACTC1 cardiac muscle 1

---

Tested Applications

• Positive WB detected in: mouse heart tissue, mouse skeletal muscle tissue, mouse thymus tissue
• Positive IP detected in: mouse heart tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 3 publications below
• IHC: See 1 publications below

Product Information

11032-1-AP targets Alpha cardiac muscle actin in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1471

  Product name: Recombinant human ACTC1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-377 aa of BC009978

  Sequence: MCDDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF

• Full Name: actin, alpha, cardiac muscle 1
• Calculated Molecular Weight: 377 aa, 42 kDa
• Observed Molecular Weight: 42 kDa
• GenBank Accession Number: BC009978
• Gene Symbol: ACTC1
• Gene ID (NCBI): 70
• RRID: AB_2242376
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P68032
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	FASEB J; Zbtb20 deficiency causes cardiac contractile dysfunction in mice.; Authors - An-Jing Ren
human	WB	Int J Biol Sci; MnSOD Lysine 68 acetylation leads to cisplatin and doxorubicin resistance due to aberrant mitochondrial metabolism.; Authors - Yucheng Gao
human	IHC	Stem Cells Dev; A model of early human embryonic stem cell differentiation reveals inter- and intracellular changes on transition to squamous epithelium.; Authors - Galat Vasiliy V
human	WB	Onco Targets Ther; Clinical Significance and Oncogenic Activity of GRWD1 Overexpression in the Development of Colon Carcinoma.; Authors - Xin Zhou