Amphiregulin Monoclonal antibody, PBS Only

Amphiregulin Monoclonal Antibody for WB, IHC, Indirect ELISA
Cat No. 66433-1-PBS
Clone No.1A1G9

Host / Isotype

Mouse / IgG1

Reactivity

human, rat, pig

Applications

WB, IHC, Indirect ELISA

AREG, 1A1G9, AR, AREGB, Colorectum cell-derived growth factor

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66433-1-PBS targets Amphiregulin in WB, IHC, Indirect ELISA applications and shows reactivity with human, rat, pig samples.

Tested Reactivity human, rat, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag8907

Product name: Recombinant human AREG protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 25-252 aa of BC009799

Sequence: AGLDLNDTYSGKREPFSGDHSADGFEVTSRSEMSSGSEISPVSEMPSSSEPSSGADYDYSEEYDNEPQIPGYIVDDSVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEKSMKTHSMIDSSLSKIALAAIAAFMSAVILTAVAVITVQLRRQYVRKYEGEAEERKKLRQENGNVHAIA

Predict reactive species
Full Name amphiregulin
Calculated Molecular Weight 252 aa, 28 kDa
Observed Molecular Weight 50 kDa, 37 kDa
GenBank Accession NumberBC009799
Gene Symbol Amphiregulin/AREG
Gene ID (NCBI) 374
RRIDAB_2881803
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP15514
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Amphiregulin (AREG) is one of the ligands of the epidermal growth factor receptor (EGFR). AREG plays a central role in mammary gland development and branching morphogenesis in organs and is expressed both in physiological and in cancerous tissues. The AREG protein is synthesized as a 252-amino acid transmembrane precursor, pro-AREG. At the plasma membrane, pro-AREG is subjected to sequential proteolytic cleavages within its ectodomain and is then released as the soluble AREG protein. Depending on the cell type and microenvironment, AREG can be produced in multiple cellular and mature forms using alternative pro-AREG cleavage sites and glycosylation motifs. Post-translastional modfications of 50-kDa pro-AREG produces a major soluble 43-kDa form, 28-, 26-, 16-kDa membrane anchored forms, and soluble 21-, 19-, and 9-kDa forms (PMID: 9642297).

Loading...
||
New chat

Able

正在加载,请稍候...