Ataxin 2 Recombinant monoclonal antibody, PBS Only (Capture)

• 

  WB analysis using 80919-2-RR (same clone as 80919-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 80919-2-RR (Ataxin 2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 80919-2-PBS in a different storage buffer formulation.

• 

  WB analysis of HSC-T6 using 80919-2-RR (same clone as 80919-2-PBS)

  HSC-T6 cells were subjected to SDS PAGE followed by western blot with 80919-2-RR (Ataxin 2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 80919-2-PBS in a different storage buffer formulation.

• 

  WB analysis using 80919-2-RR (same clone as 80919-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 80919-2-RR (Ataxin 2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 80919-2-PBS in a different storage buffer formulation.

• 

  Sandwich ELISA sample test of MP02584-1

  The mean Ataxin 2 concentration was determined to be 2.25 ng/mL in HepG2 cell extract based on a 1.3 mg/mL extract load.

• 

  Sandwich ELISA standard curve of MP02584-1

  Sandwich ELISA standard curve of MP02584-1, Human Ataxin 2 Recombinant Matched Antibody Pair - PBS only. 80919-2-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag16470. 80919-4-PBS was HRP conjugated as the detection antibody. Range: 62.5-4000 pg/mL

• 

  IP experiment of NIH/3T3 using 80919-2-RR (same clone as 80919-2-PBS)

  IP result of anti-Ataxin 2 (IP:80919-2-RR, 4ug; Detection:80919-2-RR 1:1000) with NIH/3T3 cells lysate 1200 ug. This data was developed using the same antibody clone with 80919-2-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 80919-2-RR (same clone as 80919-2-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 80919-2-RR (Ataxin 2 antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 80919-2-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 80919-2-RR (same clone as 80919-2-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using Ataxin 2 antibody (80919-2-RR, Clone: 250888E4 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 80919-2-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 80919-2-RR

  Biolayer interferometry (BLl) kinetic assays of 80919-2-RR against Human Ataxin 2 were performed. The affinity constant is 0.153 nM.

Ataxin 2 Uni-rAb^® Recombinant Antibody for WB, IHC, IF-P, IP, Sandwich ELISA, Indirect ELISA

Cat No. 80919-2-PBS

Clone No.250888E4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, IP, Sandwich ELISA, Indirect ELISA

Synonyms

ATXN2, ataxin2, Ataxin-2, ATX2, ATXN 2

---

Product Information

80919-2-PBS targets Ataxin 2 as part of a matched antibody pair:

MP02584-1: 80919-2-PBS capture and 80919-4-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag16470

  Product name: Recombinant human Ataxin 2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 251-600 aa of BC114546

  Sequence: GSDQRVVNGGVPWPSPCPSPSSRPPSRYQSGPNSLPPRAATPTRPPSRPPSRPSRPPSHPSAHGSPAPVSTMPKRMSSEGPPRMSPKAQRHPRNHRVSAGRGSISSGLEFVSHNPPSEAATPPVARTSPSGGTWSSVVSGVPRLSPKTHRPRSPRQNSIGNTPSGPVLASPQAGIIPTEAVAMPIPAASPTPASPASNRAVTPSSEAKDSRLQDQRQNSPAGNKENIKPNETSPSFSKAENKGISPVVSEHRKQIDDLKKFKNDFRLQPSSTSESMDQLLNKNREGEKSRDLIKDKIEPSAKDSFIENSSSNCTSGSSKPNSPSISPSILSNTEHKRGPEVTSQGVQTSS

• Full Name: ataxin 2
• Calculated Molecular Weight: 1313 aa, 140 kDa
• Observed Molecular Weight: 140-150 kDa
• GenBank Accession Number: BC114546
• Gene Symbol: ATXN2
• Gene ID (NCBI): 6311
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q99700
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ATXN2 contains a repeat structure with 22 or 23 triplets coding for glutamine and the (CAG)8CAA(CAG)4CAA(CAG)8 sequence; expansion of this domain to a size ≥34 triplets with a pure CAG sequence primarily causes autosomal dominant SCA2 [PMID:18418684], while ATXN2 expansions with CAA interruptions were observed as the cause of Levo-dopa responsive Parkinson's disease [PMID:10668726]. ATXN2 expansions associated with ALS were reported to be interrupted by at least one CAA triplet [PMID:21537950]