Ataxin 2 Recombinant monoclonal antibody, PBS Only (Capture)

Ataxin 2 Uni-rAb® Recombinant Antibody for WB, IHC, IF-P, IP, Sandwich ELISA, Indirect ELISA
Cat No. 80919-2-PBS
Clone No.250888E4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, IP, Sandwich ELISA, Indirect ELISA

ATXN2, ataxin2, Ataxin-2, ATX2, ATXN 2

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

80919-2-PBS targets Ataxin 2 as part of a matched antibody pair:

MP02584-1: 80919-2-PBS capture and 80919-4-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag16470

Product name: Recombinant human Ataxin 2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 251-600 aa of BC114546

Sequence: GSDQRVVNGGVPWPSPCPSPSSRPPSRYQSGPNSLPPRAATPTRPPSRPPSRPSRPPSHPSAHGSPAPVSTMPKRMSSEGPPRMSPKAQRHPRNHRVSAGRGSISSGLEFVSHNPPSEAATPPVARTSPSGGTWSSVVSGVPRLSPKTHRPRSPRQNSIGNTPSGPVLASPQAGIIPTEAVAMPIPAASPTPASPASNRAVTPSSEAKDSRLQDQRQNSPAGNKENIKPNETSPSFSKAENKGISPVVSEHRKQIDDLKKFKNDFRLQPSSTSESMDQLLNKNREGEKSRDLIKDKIEPSAKDSFIENSSSNCTSGSSKPNSPSISPSILSNTEHKRGPEVTSQGVQTSS

Predict reactive species
Full Name ataxin 2
Calculated Molecular Weight 1313 aa, 140 kDa
Observed Molecular Weight 140-150 kDa
GenBank Accession NumberBC114546
Gene Symbol ATXN2
Gene ID (NCBI) 6311
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ99700
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

ATXN2 contains a repeat structure with 22 or 23 triplets coding for glutamine and the (CAG)8CAA(CAG)4CAA(CAG)8 sequence; expansion of this domain to a size ≥34 triplets with a pure CAG sequence primarily causes autosomal dominant SCA2 [PMID:18418684], while ATXN2 expansions with CAA interruptions were observed as the cause of Levo-dopa responsive Parkinson's disease [PMID:10668726]. ATXN2 expansions associated with ALS were reported to be interrupted by at least one CAA triplet [PMID:21537950]

Loading...
||
New chat Able
正在加载,请稍候...