B4GALT2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• B4GALT2 Polyclonal antibody (20330-1-AP)

B4GALT2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 20330-1-AP Copied!

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

B4Gal T2, b4Gal-T2, Beta 1,4 GalTase 2, Beta-1,4-galactosyltransferase 2, Beta-1,4-GalTase 2

• 

  WB analysis of PC-3 using 20330-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 20330-1-AP (B4GALT2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse large intestine using 20330-1-AP

  mouse large intestine tissue were subjected to SDS PAGE followed by western blot with 20330-1-AP (B4GALT2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 20330-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 20330-1-AP (B4GALT2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse ovary using 20330-1-AP

  mouse ovary tissue were subjected to SDS PAGE followed by western blot with 20330-1-AP (B4GALT2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse skeletal muscle using 20330-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 20330-1-AP (B4GALT2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 20330-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer using 20330-1-AP (B4GALT2 antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 20330-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer using 20330-1-AP (B4GALT2 antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 20330-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer using 20330-1-AP (B4GALT2 antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 20330-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer using 20330-1-AP (B4GALT2 antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary using 20330-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary using 20330-1-AP (B4GALT2 antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary using 20330-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary using 20330-1-AP (B4GALT2 antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for B4GALT2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: PC-3 cells, mouse brain tissue, mouse large intestine tissue, mouse ovary tissue, mouse skeletal muscle tissue
• Positive IHC detected in: human colon cancer tissue, human ovary tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

20330-1-AP targets B4GALT2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14046

  Product name: Recombinant human B4GALT2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 60-176 aa of BC002431

  Sequence: PGVLMGGRYTPPDCTPAQTVAVIIPFRHREHHLRYWLHYLHPILRRQRLRYGVYVINQHGEDTFNRAKLLNVGFLEALKEDAAYDCFIFSDVDLVPMDDRNLYRCGDQPRHFAIAMD

• Full Name: UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2
• Calculated Molecular Weight: 372 aa, 42 kDa
• Observed Molecular Weight: 42-45 kDa
• GenBank Accession Number: BC002431
• Gene Symbol: B4GALT2
• Gene ID (NCBI): 8704
• RRID: AB_10693615
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O60909
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The B4GALT2 Polyclonal antibody (Cat# 20330-1-AP) has 2 citations. One appeared in Journal for ImmunoTherapy of Cancer (IF 11.7), studying B4GALT2 as an immune exclusion regulator in lung adenocarcinoma via IHC. The other was published in Frontiers in Genetics (IF 3), identifying a glycosyltransferase prognostic signature in hepatocellular carcinoma using WB. Both studies were conducted in human samples, covering research fields of cancer immunology and oncology biomarker discovery.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	J Immunother Cancer; Novel post-translational modification learning signature reveals B4GALT2 as an immune exclusion regulator in lung adenocarcinoma; Authors - Pengpeng Zhang
human	WB	Front Genet; Identification of a Novel Glycosyltransferase Prognostic Signature in Hepatocellular Carcinoma Based on LASSO Algorithm.; Authors - Zhiyang Zhou