Tested Applications
Positive WB detected in | PC-3 cells, mouse brain tissue, mouse large intestine tissue, mouse ovary tissue, mouse skeletal muscle tissue |
Positive IHC detected in | human colon cancer tissue, human ovary tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:4000 |
Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
IHC | See 1 publications below |
Product Information
20330-1-AP targets B4GALT2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag14046 Product name: Recombinant human B4GALT2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 60-176 aa of BC002431 Sequence: PGVLMGGRYTPPDCTPAQTVAVIIPFRHREHHLRYWLHYLHPILRRQRLRYGVYVINQHGEDTFNRAKLLNVGFLEALKEDAAYDCFIFSDVDLVPMDDRNLYRCGDQPRHFAIAMD Predict reactive species |
Full Name | UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2 |
Calculated Molecular Weight | 372 aa, 42 kDa |
Observed Molecular Weight | 42-45 kDa |
GenBank Accession Number | BC002431 |
Gene Symbol | B4GALT2 |
Gene ID (NCBI) | 8704 |
RRID | AB_10693615 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O60909 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for B4GALT2 antibody 20330-1-AP | Download protocol |
IHC protocol for B4GALT2 antibody 20330-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Front Genet Identification of a Novel Glycosyltransferase Prognostic Signature in Hepatocellular Carcinoma Based on LASSO Algorithm. | ||
J Immunother Cancer Novel post-translational modification learning signature reveals B4GALT2 as an immune exclusion regulator in lung adenocarcinoma |