B4GALT4 Polyclonal antibody, PBS Only

• 

  WB analysis using 30478-1-AP (same clone as 30478-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30478-1-AP (B4GALT4 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30478-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A549 using 30478-1-AP (same clone as 30478-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A549 cells using B4GALT4 antibody (30478-1-AP) at dilution of 1:2000 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red). This data was developed using the same antibody clone with 30478-1-PBS in a different storage buffer formulation.

B4GALT4 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 30478-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

30478-1-PBS targets B4GALT4 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32337

  Product name: Recombinant human B4GALT4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 39-142 aa of BC004523

  Sequence: QEIPKAKEFMANFHKTLILGKGKTLTNEASTKKVELDNCPSVSPYLRGQSKLIFKPDLTLEEVQAENPKVSRGRYRPEECKALQRVAILVPHRNREKHLMYLLE

• Full Name: UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 4
• Calculated Molecular Weight: 40 kDa
• Observed Molecular Weight: 34-40 kDa
• GenBank Accession Number: BC004523
• Gene Symbol: B4GALT4
• Gene ID (NCBI): 8702
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O60513
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.