Tested Applications
Positive WB detected in | Daudi cells, Ramos cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:4000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 3 publications below |
IHC | See 1 publications below |
Product Information
27635-1-AP targets BACH2 in WB, IHC, ELISA applications and shows reactivity with Human samples.
Tested Reactivity | Human |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag26526 Product name: Recombinant human BACH2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 136-235 aa of NM_001170794 Sequence: MSEDGLFVCRKDAACQRPHEDCENSAGEEEDEEEETMDSETAKMACPRDQMLPEPISFEAAAIPVAEKEEALLPEPDVPTDTKESSEKDALTQYPRYKKYQ Predict reactive species |
Full Name | BTB and CNC homology 1, basic leucine zipper transcription factor 2 |
Calculated Molecular Weight | 93 kDa |
Observed Molecular Weight | 120-130 kDa |
GenBank Accession Number | NM_001170794 |
Gene Symbol | BACH2 |
Gene ID (NCBI) | 60468 |
RRID | AB_2880934 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9BYV9 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
BACH2, also named as Transcription regulator protein BACH2, is a 841 amino acid protein, which is widely expressed within the B-lymphoid lineage, except in plasma cells. BACH2 contains an N-terminal BTB domain involved in its transcriptional function, but instead of having zinc fingers at the C-terminus, it binds to DNA through a basic leucine zipper motif. BACH2 binds DNA consensus sequences, termed MARE motifs, by forming a heterodimer with small leucine zipper MAF proteins such as MAFK, MAFG, and MAFF. The calculated molecular weight of BACH2 is 92 kDa, but the post-modifiction of BACH2 is about 120-130 kDa. (PMID: 24277074 )
Protocols
Product Specific Protocols | |
---|---|
WB protocol for BACH2 antibody 27635-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
FEBS Open Bio Bach2 overexpression represses Th9 cell differentiation by suppressing IRF4 expression in systemic lupus erythematosus.
| ||
Cell Rep Class I HDAC inhibitors enhance antitumor efficacy and persistence of CAR-T cells by activation of the Wnt pathway | ||
World J Surg Oncol Prognostic value of circadian rhythm-associated genes in breast cancer |