BACH2 Polyclonal antibody, PBS Only

• 

  WB analysis of Daudi using 27635-1-AP (same clone as 27635-1-PBS)

  Daudi cells were subjected to SDS PAGE followed by western blot with 27635-1-AP (BACH2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27635-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Ramos using 27635-1-AP (same clone as 27635-1-PBS)

  Ramos cells were subjected to SDS PAGE followed by western blot with 27635-1-AP (BACH2 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27635-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Daudi using 27635-1-AP (same clone as 27635-1-PBS)

  Daudi cells were subjected to SDS PAGE followed by western blot with 27635-1-AP (BACH2 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27635-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

BACH2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 27635-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

27635-1-PBS targets BACH2 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26526

  Product name: Recombinant human BACH2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 136-235 aa of NM_001170794

  Sequence: MSEDGLFVCRKDAACQRPHEDCENSAGEEEDEEEETMDSETAKMACPRDQMLPEPISFEAAAIPVAEKEEALLPEPDVPTDTKESSEKDALTQYPRYKKYQ

• Full Name: BTB and CNC homology 1, basic leucine zipper transcription factor 2
• Calculated Molecular Weight: 93 kDa
• Observed Molecular Weight: 120-130 kDa
• GenBank Accession Number: NM_001170794
• Gene Symbol: BACH2
• Gene ID (NCBI): 60468
• RRID: AB_2880934
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BYV9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

BACH2, also named as Transcription regulator protein BACH2, is a 841 amino acid protein, which is widely expressed within the B-lymphoid lineage, except in plasma cells. BACH2 contains an N-terminal BTB domain involved in its transcriptional function, but instead of having zinc fingers at the C-terminus, it binds to DNA through a basic leucine zipper motif. BACH2 binds DNA consensus sequences, termed MARE motifs, by forming a heterodimer with small leucine zipper MAF proteins such as MAFK, MAFG, and MAFF. The calculated molecular weight of BACH2 is 92 kDa, but the post-modifiction of BACH2 is about 120-130 kDa. (PMID: 24277074 )