Published Applications
| WB | See 32 publications below |
| IHC | See 2 publications below |
| IF | See 1 publications below |
Product Information
14673-1-AP targets BAK in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, chicken, sheep |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag6354 Product name: Recombinant human BAK protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 43-205 aa of BC004431 Sequence: HQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNGPILNVLVVLGVVLLGQFVV Predict reactive species |
| Full Name | BCL2-antagonist/killer 1 |
| Calculated Molecular Weight | 23 kDa |
| GenBank Accession Number | BC004431 |
| Gene Symbol | BAK1 |
| Gene ID (NCBI) | 578 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q16611 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
BAK1, also named as BAK, BCL2L7 and CDN1, belongs to the Bcl-2 family. In the presence of an appropriate stimulus, BAK1 accelerates programmed cell death by binding to, and antagonizing the anti-apoptotic action of BCL2 or its adenovirus homolog E1B 19k protein. Low micromolar levels of zinc ions inhibit the promotion of apoptosis. (PMID:17157251) BAK1 gene product primarily enhances apoptotic cell death following an appropriate stimulus. It can inhibit cell death in an Epstein-Barr virus-transformed cell line.
Publications
| Species | Application | Title |
|---|---|---|
Cell Death Differ ZNF451 collaborates with RNF8 to regulate RNF168 localization and amplify ubiquitination signaling to promote DNA damage repair and regulate radiosensitivity | ||
Nat Commun Mitochondrial membrane proteins and VPS35 orchestrate selective removal of mtDNA | ||
Sci Total Environ MitomiR-1736-3p regulates copper-induced mitochondrial pathway apoptosis by inhibiting AATF in chicken hepatocytes | ||
Oncotarget By reducing hexokinase 2, resveratrol induces apoptosis in HCC cells addicted to aerobic glycolysis and inhibits tumor growth in mice. | ||
Mol Ther Nucleic Acids lncRNA MIRF Promotes Cardiac Apoptosis through the miR-26a-Bak1 Axis. | ||
J Proteome Res PPE38 of Mycobacterium marinum triggers the cross-talk of multiple pathways involved in the host response, as revealed by subcellular quantitative proteomics. |
