BAX Recombinant monoclonal antibody, PBS Only (Detector)

• 

  Sandwich ELISA sample test of MP02957-1

  The mean BAX concentration was determined to be 489.00 ng/mL in HepG2 cell extract based on a 1.20 mg/mL extract load, 111.60 ng/mL in HeLa cell extract based on a 1.20 mg/mL extract load and 19.30 ng/mL in PC-3 cell extract based on a 1.30 mg/mL extract load.

• 

  Sandwich ELISA standard curve of MP02957-1

  Sandwich ELISA standard curve of MP02957-1, Human BAX Recombinant Matched Antibody Pair - PBS only. 81789-3-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag40421. 81789-2-PBS was HRP conjugated as the detection antibody. Range: 0.156-10 ng/mL.

• 

  Cytometric bead array sample test of MP02957-1

  The mean BAX concentration was determined to be 491.4 ng/mL in HepG2 cell extract based on a 1.2 mg/mL extract load, 74.5 ng/mL in HeLa cell extract based on a 1.2 mg/mL extract load.

• 

  Cytometric bead array standard curve of MP02957-1

  Cytometric bead array standard curve of MP02957-1, BAX Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 81789-3-PBS. Detection antibody: 81789-2-PBS. Standard: Ag40421. Range: 0.312-40 ng/mL.

BAX Uni-rAb^® Recombinant Antibody for Cytometric bead array, Sandwich ELISA, Indirect ELISA

Cat No. 81789-2-PBS

Clone No.252648B5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Sandwich ELISA, Indirect ELISA

Synonyms

---

Product Information

81789-2-PBS targets BAX as part of a matched antibody pair:

MP02957-1: 81789-3-PBS capture and 81789-2-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag40421

  Product name: Recombinant human BAX protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-151 aa of BC014175

  Sequence: MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGW

• Full Name: BCL2-associated X protein
• Calculated Molecular Weight: 21 kDa
• GenBank Accession Number: BC014175
• Gene Symbol: BAX
• Gene ID (NCBI): 581
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q07812
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.