BBIP1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• BBIP1 Polyclonal antibody, PBS Only (33050-1-PBS)

• 

  WB analysis using 33050-1-AP (same clone as 33050-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 33050-1-AP (BBIP1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 33050-1-PBS in a different storage buffer formulation.

• 

  WB analysis of U-87 MG using 33050-1-AP (same clone as 33050-1-PBS)

  WB result of BBIP1 antibody (33050-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-BBIP1 transfected U-87 MG cells. This data was developed using the same antibody clone with 33050-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

BBIP1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 33050-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

BBIP10, BBSome Interacting Protein 1, BBSome-interacting protein 1, BBSome-interacting protein of 10 kDa, NCRNA00081

---

Product Information

33050-1-PBS targets BBIP1 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36924

  Product name: Recombinant human BBIP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-92 aa of BC015550

  Sequence: MLKAAAKRPELSGKNTISNNSDMAEVKSMFREVLPKQGPLFVEDIMTMVLCKPKLLPLKSLTLEKLEKMHQAAQNTIRQQEMAEKDQRQITH*

• Full Name: non-protein coding RNA 81
• Observed Molecular Weight: 22 kDa
• GenBank Accession Number: BC015550
• Gene Symbol: NCRNA00081
• Gene ID (NCBI): 92482
• RRID: AB_3742837
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: A8MTZ0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The BBIP1 protein is a key component of the BBSome complex and was identified due to its role in the pathogenesis of Bardet-Biedl syndrome (BBS). This protein localizes to the base of cellular cilia and plays an indispensable role in ciliary assembly, maintenance, and signal transduction. As an adapter for membrane protein trafficking, BBIP1 works in coordination with other members of the BBSome to precisely transport specific cargo proteins into the cilium, an important cellular organelle. Loss of its function disrupts the stability of the BBSome complex, leading to abnormalities in ciliary structure and function. This, in turn, causes various clinical symptoms of BBS, including retinal degeneration, obesity, and polydactyly. Therefore, research on BBIP1 is central to understanding the molecular basis of cilia-related diseases (ciliopathies).