Tested Applications
| Positive WB detected in | A431 cells, HT-29 cells, human placenta tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:16000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| IF | See 1 publications below |
Product Information
26528-1-AP targets BCAM in WB, IF, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24753 Product name: Recombinant human BCAM protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 569-628 aa of BC050450 Sequence: YCVRRKGGPCCRQRREKGAPPPGEPGLSHSGSEQPEQTGLLMGGASGGARGGSGGFGDEC Predict reactive species |
| Full Name | basal cell adhesion molecule (Lutheran blood group) |
| Calculated Molecular Weight | 67 kDa |
| Observed Molecular Weight | 67 kDa, 78-85 kDa |
| GenBank Accession Number | BC050450 |
| Gene Symbol | BCAM |
| Gene ID (NCBI) | 4059 |
| RRID | AB_3669545 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P50895 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Basal cell adhesion molecule (Lu/BCAM) is a membrane-bound glycoprotein of the immunoglobulin superfamily (IgSF), functioning as a receptor for the extracellular matrix protein, laminin. BCAM (Lutheran/basal cell-adhesion molecule, a glycoprotein) belongs to the immunoglobulin superfamily which contains both Lu blood group and BCAM tumor-associated antigens. Proteomics analysis suggests that BCAM might be a potential biomarker for pancreatic cancer (PMID: 19199705). BCAM, involved in cell adhesion and migration, can also promote tumor metastasis and has been elucidated to play a functional role in the metastasis of thyroid cancer and gastric cancer (PMID: 10728810, 35941663). De-glycosylated BCAM has a preidicted molecular weight of 67 kDa. Two BCAM glycoprotein (gp) isoforms are present on human RBCs, Lu (85 kDa) and Lu(v13) (78 kDa); they result from the alternative splicing of intron 13 and differ by the lengths of their cytoplasmic domains (PMID: 23160466).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for BCAM antibody 26528-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

