BCAT1 Polyclonal antibody, PBS Only

• 

  WB analysis using 28622-1-AP (same clone as 28622-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 28622-1-AP (BCAT1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28622-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 28622-1-AP (same clone as 28622-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 28622-1-AP (BCAT1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28622-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 28622-1-AP (same clone as 28622-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 28622-1-AP (BCAT1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28622-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human gliomas using 28622-1-AP (same clone as 28622-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 28622-1-AP (BCAT1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28622-1-PBS in a different storage buffer formulation.

BCAT1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 28622-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

28622-1-PBS targets BCAT1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28998

  Product name: Recombinant human BCAT1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-115 aa of BC033864

  Sequence: MDCSNGCSAECTGEGGSKEVVGTFKAKDLIVTPATILKEKPDPNNLVFGTVFTDHMLTVEWSSEFGWEKPHIKPLQNLSLHPGSSALHYAVELFEGLKAFRGVDNKIRLFQPNLN

• Full Name: branched chain aminotransferase 1, cytosolic
• Calculated Molecular Weight: 320 aa, 36 kDa
• Observed Molecular Weight: 43-48 kDa
• GenBank Accession Number: BC033864
• Gene Symbol: BCAT1
• Gene ID (NCBI): 586
• RRID: AB_2881183
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P54687
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

BCAT1, also named as branched-chain amino acid trasaminase1, is a cytosolic enzyme responsible for the reversible transamination of leucine, isoleucine and valine that catalyzes the transformation of branched-chain L-amino acids (BCAA) into branched-chain a-ketoacids (BCKA), thereby providing macromolecule precursors. It has been reported that BCAT1 is associated with tumor growth and disease progression (PMID:29255149).