Tested Applications
| Positive WB detected in | C6 cells, Jurkat cells |
| Positive IHC detected in | human liver cancer tissue, human lung cancer tissue, human gliomas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
| IHC | See 2 publications below |
Product Information
28622-1-AP targets BCAT1 in WB, IHC, ELISA applications and shows reactivity with Human, rat samples.
| Tested Reactivity | Human, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag28998 Product name: Recombinant human BCAT1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-115 aa of BC033864 Sequence: MDCSNGCSAECTGEGGSKEVVGTFKAKDLIVTPATILKEKPDPNNLVFGTVFTDHMLTVEWSSEFGWEKPHIKPLQNLSLHPGSSALHYAVELFEGLKAFRGVDNKIRLFQPNLN Predict reactive species |
| Full Name | branched chain aminotransferase 1, cytosolic |
| Calculated Molecular Weight | 320 aa, 36 kDa |
| Observed Molecular Weight | 43-48 kDa |
| GenBank Accession Number | BC033864 |
| Gene Symbol | BCAT1 |
| Gene ID (NCBI) | 586 |
| RRID | AB_2881183 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P54687 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
BCAT1, also named as branched-chain amino acid trasaminase1, is a cytosolic enzyme responsible for the reversible transamination of leucine, isoleucine and valine that catalyzes the transformation of branched-chain L-amino acids (BCAA) into branched-chain a-ketoacids (BCKA), thereby providing macromolecule precursors. It has been reported that BCAT1 is associated with tumor growth and disease progression (PMID:29255149).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for BCAT1 antibody 28622-1-AP | Download protocol |
| WB protocol for BCAT1 antibody 28622-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Oncol Rep BCAT1 overexpression regulates proliferation and c‑Myc/GLUT1 signaling in head and neck squamous cell carcinoma. | ||
Biochim Biophys Acta Mol Basis Dis Targeted inhibition of branched-chain amino acid metabolism drives apoptosis of glioblastoma by facilitating ubiquitin degradation of Mfn2 and oxidative stress |







