BCAT1 Polyclonal antibody

• 

  WB analysis using 28622-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28622-1-AP (BCAT1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver cancer using 28622-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 28622-1-AP (BCAT1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 28622-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 28622-1-AP (BCAT1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human gliomas using 28622-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 28622-1-AP (BCAT1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

BCAT1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 28622-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

Human, rat and More (2)

Applications

WB, IHC, ELISA

Synonyms

BCAT1, DKFZp686E12175, ECA39, MECA39, PNAS 121, PP18, Protein ECA39

---

Tested Applications

• Positive WB detected in: C6 cells, Jurkat cells
• Positive IHC detected in: human liver cancer tissue, human lung cancer tissue, human gliomas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IHC: See 2 publications below

Product Information

28622-1-AP targets BCAT1 in WB, IHC, ELISA applications and shows reactivity with Human, rat samples.

• Tested Reactivity: Human, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28998

  Product name: Recombinant human BCAT1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-115 aa of BC033864

  Sequence: MDCSNGCSAECTGEGGSKEVVGTFKAKDLIVTPATILKEKPDPNNLVFGTVFTDHMLTVEWSSEFGWEKPHIKPLQNLSLHPGSSALHYAVELFEGLKAFRGVDNKIRLFQPNLN

• Full Name: branched chain aminotransferase 1, cytosolic
• Calculated Molecular Weight: 320 aa, 36 kDa
• Observed Molecular Weight: 43-48 kDa
• GenBank Accession Number: BC033864
• Gene Symbol: BCAT1
• Gene ID (NCBI): 586
• RRID: AB_2881183
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P54687
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

BCAT1, also named as branched-chain amino acid trasaminase1, is a cytosolic enzyme responsible for the reversible transamination of leucine, isoleucine and valine that catalyzes the transformation of branched-chain L-amino acids (BCAA) into branched-chain a-ketoacids (BCKA), thereby providing macromolecule precursors. It has been reported that BCAT1 is associated with tumor growth and disease progression (PMID:29255149).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Oncol Rep; BCAT1 overexpression regulates proliferation and c‑Myc/GLUT1 signaling in head and neck squamous cell carcinoma.; Authors - Hongming Wang
mouse	WB,IHC	Biochim Biophys Acta Mol Basis Dis; Targeted inhibition of branched-chain amino acid metabolism drives apoptosis of glioblastoma by facilitating ubiquitin degradation of Mfn2 and oxidative stress; Authors - Zhuo Lu