Tested Applications
| Positive WB detected in | C6 cells, Jurkat cells |
| Positive IHC detected in | human liver cancer tissue, human lung cancer tissue, human gliomas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
28622-1-AP targets BCAT1 in WB, IHC, ELISA applications and shows reactivity with Human, rat samples.
| Tested Reactivity | Human, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag28998 Product name: Recombinant human BCAT1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-115 aa of BC033864 Sequence: MDCSNGCSAECTGEGGSKEVVGTFKAKDLIVTPATILKEKPDPNNLVFGTVFTDHMLTVEWSSEFGWEKPHIKPLQNLSLHPGSSALHYAVELFEGLKAFRGVDNKIRLFQPNLN Predict reactive species |
| Full Name | branched chain aminotransferase 1, cytosolic |
| Calculated Molecular Weight | 320 aa, 36 kDa |
| Observed Molecular Weight | 43-48 kDa |
| GenBank Accession Number | BC033864 |
| Gene Symbol | BCAT1 |
| Gene ID (NCBI) | 586 |
| RRID | AB_2881183 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P54687 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
BCAT1, also named as branched-chain amino acid trasaminase1, is a cytosolic enzyme responsible for the reversible transamination of leucine, isoleucine and valine that catalyzes the transformation of branched-chain L-amino acids (BCAA) into branched-chain a-ketoacids (BCKA), thereby providing macromolecule precursors. It has been reported that BCAT1 is associated with tumor growth and disease progression (PMID:29255149).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for BCAT1 antibody 28622-1-AP | Download protocol |
| WB protocol for BCAT1 antibody 28622-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-BCAT1 (Cat# 28622-1-AP) has 3 total citations published in Biochim Biophys Acta Mol Basis Dis, Oncol Rep, and Funct Integr Genomics. The research fields span cancer biology and metabolism, specifically investigating BCAT1's roles in glioblastoma apoptosis via Mfn2 ubiquitin degradation, proliferation and c-Myc/GLUT1 signaling in head and neck squamous cell carcinoma, and PI3K/AKT/mTOR pathway-driven progression in bladder urothelial carcinoma. Applications include WB and IHC in mouse and human samples.
| Species | Application | Title |
|---|---|---|
Biochim Biophys Acta Mol Basis Dis Targeted inhibition of branched-chain amino acid metabolism drives apoptosis of glioblastoma by facilitating ubiquitin degradation of Mfn2 and oxidative stress | ||
Oncol Rep BCAT1 overexpression regulates proliferation and c‑Myc/GLUT1 signaling in head and neck squamous cell carcinoma. | ||
Funct Integr Genomics The BCAA metabolism-related gene BCAT1 promotes the progression of bladder urothelial carcinoma through the PI3K/AKT/mTOR signalling pathway. |
