BCRP/ABCG2 Polyclonal antibody

• 

BCRP/ABCG2 Polyclonal Antibody for ELISA

Cat No. 10180-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

ABC15, ABCG2, ABCP, BMDP, CD338, CDw338, EST157481, MRX, MXR, MXR1

---

Published Applications

• WB: See 3 publications below
• IHC: See 1 publications below

Product Information

10180-1-AP targets BCRP/ABCG2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0223

  Product name: Recombinant human BCRP,ABCG2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-249 aa of BC021281

  Sequence: MSSSNVEVFIPVSQGNTNGFPATASNDLKAFTEGAVLSFHNICYRVKLKSGFLPCRKPVEKEILSNINGIMKPGLNAILGPTGGGKSSLLDVLAARKDPSGLSGDVLINGAPRPANFKCNSGYVVQDDVVMGTLTVRENLQFSAALRLATTMTNHEKNERINRVIQELGLDKVADSKVGTQFIRGVSGGERKRTSIGMELITDPSILFLDEPTTGLDSSTANAVLLLLKRMSKQGRTIIFSIHQPRYSI

• Full Name: ATP-binding cassette, sub-family G (WHITE), member 2
• Calculated Molecular Weight: 70 kDa
• GenBank Accession Number: BC021281
• Gene Symbol: ABCG2
• Gene ID (NCBI): 9429
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UNQ0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

BCRP (breast cancer resistance protein) confers a broad spectrum of drug resistance and the expression of BCRP is enhanced in several cancer cell models. It has ATPase activity and belongs to a family of multiple drug resistant proteins. Data also indicated that BCRP might be an early marker for some stem cells.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB	Food Funct; Urate-lowering and renal-protective effects of sugarcane polyphenols in hyperuricemia: mechanisms and key components; Authors - Kexin Li
mouse	WB	ACS Pharmacol Transl Sci; Limosilactobacillus fermentum M5e Attenuates Hyperuricemia and Renal Injury via Dual Modulation of Gut Microbiota and Purine Metabolic Pathways; Authors - Yi He
human	WB,IHC	Adv Sci (Weinh); Fusidic Acid Reverses Chemoresistance in Breast Cancer via Targeting DDX6 to Downregulate GSK-3β/β-Catenin Signaling; Authors - Xiaxia Fan