Tested Applications
| Positive WB detected in | A549 cells, MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
17847-1-AP targets BDKRB2 in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag12268 Product name: Recombinant human BDKRB2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 291-391 aa of BC074895 Sequence: FLDTLHRLGILSSCQDERIIDVITQIASFMAYSNSCLNPLVYVIVGKRFRKKSWEVYQGVCQKGGCRSEPIQMENSMGTLRTSISVERQIHKLQDWAGSRQ Predict reactive species |
| Full Name | bradykinin receptor B2 |
| Calculated Molecular Weight | 391 aa, 44 kDa |
| Observed Molecular Weight | 44 kDa |
| GenBank Accession Number | BC074895 |
| Gene Symbol | BDKRB2 |
| Gene ID (NCBI) | 624 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P30411 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The BK system is important in cancer occurrence and progression. It stimulates cell proliferation, migration, and angiogenesis, contributing to tumor progression. As a vital receptor of bradykinin, BDKRB2 (Bradykinin receptor B2) has been widely reported in a range of malignancies, including cervical cancer, triple-negative breast cancer, hepatocellular carcinoma (HCC), gastric cancer, colorectal cancer, prostate cancer, bladder cancer, head and neck squamous cell carcinomas, and chondrosarcoma (PMID: 33686021).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for BDKRB2 antibody 17847-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

