BDNF Polyclonal antibody

• Home
• Products
• Primary Antibodies
• BDNF Polyclonal antibody (28205-1-AP)

BDNF Polyclonal Antibody for WB, IHC, ELISA

Cat No. 28205-1-AP

Publications(225)

Reviews (2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Synonyms

BDNF precursor form, brain derived neurotrophic factor, Brain-derived neurotrophic factor

• 

  WB analysis using 28205-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28205-1-AP (BDNF antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 28205-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28205-1-AP (BDNF antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 28205-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28205-1-AP (BDNF antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of SH-SY5Y using 28205-1-AP

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 28205-1-AP (BDNF antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse cerebellum using 28205-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 28205-1-AP (BDNF antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse cerebellum using 28205-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 28205-1-AP (BDNF antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: mouse brain tissue, mouse cerebellum tissue, PC-12 cells, SH-SY5Y cells, rat brain tissue, rat cerebellum, C6 cells
• Positive IHC detected in: mouse cerebellum tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunohistochemistry (IHC): IHC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28205-1-AP targets BDNF in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28276

  Product name: Recombinant human BDNF protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 129-247 aa of BC029795

  Sequence: HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR

• Full Name: brain-derived neurotrophic factor
• Calculated Molecular Weight: 247 aa, 28 kDa
• Observed Molecular Weight: 28-30 kDa
• GenBank Accession Number: BC029795
• Gene Symbol: BDNF
• Gene ID (NCBI): 627
• RRID: AB_2818984
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P23560
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

1) What is BDNF?

BDNF (brain-derived neurotrophic factor) is a small secreted growth factor that is important for the development and plasticity of the central nervous system and vital for long-term memory. Selected polymorphisms of BDNF have been shown to increase susceptibility to memory impairment and selected eating and mental disorders.

2) FAQs for BDNF

A) I can detect more than one band in my samples
BDNF is a neurotrophin that is a subject of maturation by proteolytic cleavage. The precursor protein (pre-proBDNF) is first cleaved to proBDNF (~34 kDa) by removing a signal peptide, and then to a mature form of BDNF (14 kDa). Additionally, (pre-)proBDNF can form dimers that run between 50 and 60 kDa, and a minor truncated form of proBDNF running at 28 kDa has also been reported (PMID: 11152678).

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB,IF	Adv Mater; Flexible Living Artificial Dura Mater for Efficient Therapy of Central Nervous System Injury Based on Neuronal Differentiation and Neuroprotective A2 Astrocyte Activation.; Authors - Hongru Yang
		Autophagy; Trehalose induces autophagy via lysosomal-mediated TFEB activation in models of motoneuron degeneration.; Authors - Paola Rusmini
mouse	WB	Nat Commun; Migration of CD8 + TSCM cells into intestine via PPBP-CXCR2 axis increases host stress susceptibility by inhibiting gut microbiome-derived homovanillic acid.; Authors - Yuan Zhang
	WB	Redox Biol; Design of anti-depressant phosphodiester amino acidic Keap1-Nrf2 protein-protein interaction inhibitors; Authors - Yi Sun
mouse	WB	Theranostics; Dopamine receptor 1 on CaMKII-positive neurons within claustrum mediates adolescent cocaine exposure-induced anxiety-like behaviors and electro-acupuncture therapy; Authors - Liying Chen
mouse	WB,IF	MedComm (2020); Enhanced effect of combining bone marrow mesenchymal stem cells (BMMSCs) and pulsed electromagnetic fields (PEMF) to promote recovery after spinal cord injury in mice; Authors - Liyi Huang

Reviews

5.0 out of 5

2 verified customer reviews

What customers say

Automatically generated from the verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Marine (Verified Customer) (07-01-2025)

This Ac worked well

• Applications: Western Blot
• Primary Antibody Dilution: 1/500 and 1/1000
• Cell Tissue Type: Tumoral cells, endothelial cells, mouse fibroblasts

Tanusree (Verified Customer) (12-18-2019)

Worked well in WB at 1:500 dilution.

• Applications: Western Blot,
• Primary Antibody Dilution: 1:500
• Cell Tissue Type: Mouse brain