Tested Applications
Positive WB detected in | mouse brain tissue, mouse cerebellum tissue, PC-12 cells, SH-SY5Y cells, rat brain tissue, rat cerebellum, C6 cells |
Positive IHC detected in | mouse cerebellum tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:8000 |
Immunohistochemistry (IHC) | IHC : 1:400-1:1600 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 139 publications below |
IHC | See 10 publications below |
IF | See 22 publications below |
Product Information
28205-1-AP targets BDNF in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag28276 Product name: Recombinant human BDNF protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 129-247 aa of BC029795 Sequence: HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR Predict reactive species |
Full Name | brain-derived neurotrophic factor |
Calculated Molecular Weight | 247 aa, 28 kDa |
Observed Molecular Weight | 28-30 kDa |
GenBank Accession Number | BC029795 |
Gene Symbol | BDNF |
Gene ID (NCBI) | 627 |
RRID | AB_2818984 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P23560 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
1) What is BDNF?
BDNF (brain-derived neurotrophic factor) is a small secreted growth factor that is important for the development and plasticity of the central nervous system and vital for long-term memory. Selected polymorphisms of BDNF have been shown to increase susceptibility to memory impairment and selected eating and mental disorders.
2) FAQs for BDNF
A) I can detect more than one band in my samples
BDNF is a neurotrophin that is a subject of maturation by proteolytic cleavage. The precursor protein (pre-proBDNF) is first cleaved to proBDNF (~34 kDa) by removing a signal peptide, and then to a mature form of BDNF (14 kDa). Additionally, (pre-)proBDNF can form dimers that run between 50 and 60 kDa, and a minor truncated form of proBDNF running at 28 kDa has also been reported (PMID: 11152678).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for BDNF antibody 28205-1-AP | Download protocol |
IHC protocol for BDNF antibody 28205-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Autophagy Trehalose induces autophagy via lysosomal-mediated TFEB activation in models of motoneuron degeneration. | ||
Mater Today Bio Injectable hyaluronic acid hydrogel loaded with BMSC and NGF for traumatic brain injury treatment. | ||
ACS Appl Mater Interfaces Reactive Oxygen Species Scavenging Functional Hydrogel Delivers Procyanidins for the Treatment of Traumatic Brain Injury in Mice. | ||
Aging Dis Dietary Salt Disrupts Tricarboxylic Acid Cycle and Induces Tau Hyperphosphorylation and Synapse Dysfunction during Aging | ||
Oncogene TRIM69 suppressed the anoikis resistance and metastasis of gastric cancer through ubiquitin‒proteasome-mediated degradation of PRKCD | ||
Phytother Res Neuroinflammation inhibition and neuroprotective effects of purpurin, a potential anti-AD compound, screened via network proximity and gene enrichment analyses |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Marine (Verified Customer) (07-01-2025) | This Ac worked well
|
FH Tanusree (Verified Customer) (12-18-2019) | Worked well in WB at 1:500 dilution.
|