Tested Applications
| Positive IHC detected in | mouse brain tissue, human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
25281-1-AP targets BEX5 in IHC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag16446 Product name: Recombinant human BEX5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-65 aa of BC106955 Sequence: MENVPKENKVVEKAPVQNEAPALGGGEYQEPGGNVKGVWAPPAPGFGEDVPNRLVDNIDMIDGDG Predict reactive species |
| Full Name | brain expressed, X-linked 5 |
| Calculated Molecular Weight | 111 aa, 13 kDa |
| GenBank Accession Number | BC106955 |
| Gene Symbol | BEX5 |
| Gene ID (NCBI) | 340542 |
| RRID | AB_3085780 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q5H9J7 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The Brain-Expressed X-linked (BEX) family proteins are comprised of five human proteins including BEX1, BEX2, BEX3, BEX4, and BEX5. While human BEX5 is widely expressed in many tissues, BEX5 has not been studied well (PMID: 26408910).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for BEX5 antibody 25281-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |





