Tested Applications
| Positive WB detected in | mouse kidney tissue, HepG2 cells, human kidney tissue, L02 cells |
| Positive IP detected in | mouse kidney tissue |
| Positive IHC detected in | human spleen tissue, human lung tissue, human ovary tissue, human placenta tissue, human skin tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse kidney tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
15965-1-AP targets BHMT in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat, pig, chicken, goat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag8738 Product name: Recombinant human BHMT protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-406 aa of BC012616 Sequence: MPPVGGKKAKKGILERLNAGEIVIGDGGFVFALEKRGYVKAGPWTPEAAVEHPEAVRQLHREFLRAGSNVMQTFTFYASEDKLENRGNYVLEKISGQEVNEAACDIARQVADEGDALVAGGVSQTPSYLSCKSETEVKKVFLQQLEVFMKKNVDFLIAEYFEHVEEAVWAVETLIASGKPVAATMCIGPEGDLHGVPPGECAVRLVKAGASIIGVNCHFDPTISLKTVKLMKEGLEAARLKAHLMSQPLAYHTPDCNKQGFIDLPEFPFGLEPRVATRWDIQKYAREAYNLGVRYIGGCCGFEPYHIRAIAEELAPERGFLPPASEKHGSWGSGLDMHTKPWVRARARKEYWENLRIASGRPYNPSMSKPDGWGVTKGTAELMQQKEATTEQQLKELFEKQKFKSQ Predict reactive species |
| Full Name | betaine-homocysteine methyltransferase |
| Calculated Molecular Weight | 406 aa, 45 kDa |
| Observed Molecular Weight | 45-50 kDa |
| GenBank Accession Number | BC012616 |
| Gene Symbol | BHMT |
| Gene ID (NCBI) | 635 |
| RRID | AB_2290472 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q93088 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Betaine-homocysteine methyltransferase (BHMT) is a cytosolic enzyme that Involved in the regulation of homocysteine metabolism. BHMT catalyzes the conversion of betaine and homocysteine to dimethylglycine and methionine, respectively. This reaction is also required for the irreversible oxidation of choline(PMID: 8798461, 10529246).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for BHMT antibody 15965-1-AP | Download protocol |
| IHC protocol for BHMT antibody 15965-1-AP | Download protocol |
| IP protocol for BHMT antibody 15965-1-AP | Download protocol |
| WB protocol for BHMT antibody 15965-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
15965-1-AP (anti-BHMT) has 43 citations across journals including Cell Discovery, Molecular Cell, Cell Reports, Cell Death & Disease, Nature Scientific Reports, PLoS One, Journal of Proteome Research, Endocrinology, and Poultry Science. Research fields span one-carbon metabolism, epigenetic DNA methylation, hepatic lipid/glucose metabolism, homocysteine regulation, cancer (melanoma, HCC, colorectal), ferroptosis, animal nutrition, and IGF signaling, with applications primarily in Western blot and IHC across human, mouse, rat, pig, and chicken species.
| Species | Application | Title |
|---|---|---|
Mol Cell mTORC1 stimulates cell growth through SAM synthesis and m6A mRNA-dependent control of protein synthesis. | ||
Cell Death Dis ILF3 promotes colorectal cancer cell resistance to ferroptosis by enhancing cysteine uptake and GSH synthesis via stabilizing SLC3A2 mRNA. | ||
NPJ Sci Food Ablation of the gut microbiota alleviates high-methionine diet-induced hyperhomocysteinemia and glucose intolerance in mice | ||
J Anim Sci Biotechnol Betaine alleviates hepatic lipid metabolism disorder in finishing pigs fed a low-energy diet through regulating m(6)A RNA methylation. | ||
J Anim Sci Biotechnol Dietary betaine activates hepaticVTGIIexpression in laying hens associated with hypomethylation ofGRgene promoter and enhancedGRexpression. |
Reviews
What customers say
The single review rated the product 5 stars for Western blotting on embryonic stem cells. The reviewer used 50 µg of protein, blocked with milk, and incubated the primary antibody at 1:1000 overnight at 4°C, reporting successful detection.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Fatemeh (Verified Customer) (05-22-2023) | 50 ug of protein was used for WB. Blot was blocked with milk and incubated with 1-1000 primary antibody overnight at 4C.
 |
