BIM/BCL2L11 Recombinant monoclonal antibody, PBS Only (Capture)

BIM/BCL2L11 Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA
Cat No. 81976-3-PBS
Clone No.252250A2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Cytometric bead array, Indirect ELISA

BCL2L11, BAM, Bcl2-interacting mediator of cell death, Bcl2-L-11, BCL2L11, BIM

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

81976-3-PBS targets BIM/BCL2L11 as part of a matched antibody pair:

MP02863-1: 81976-3-PBS capture and 81976-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag11875

Product name: Recombinant human BIM, BCL2L11 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-198 aa of BC033694

Sequence: MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH

Predict reactive species
Full Name BCL2-like 11 (apoptosis facilitator)
Calculated Molecular Weight 198 aa, 22 kDa
Observed Molecular Weight16 kDa, 23 kDa
GenBank Accession NumberBC033694
Gene Symbol Bim
Gene ID (NCBI) 10018
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO43521
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

BIM (BCL2L11) is a central BH3-only apoptosis activator that antagonizes anti-apoptotic BCL-2 proteins and directly triggers BAX/BAK-mediated mitochondrial permeabilization. Induced by cellular stress and cytokine withdrawal, BIM governs developmental cell death, immune tolerance, and tumor suppression. Alterations in BIM expression or splicing-particularly the deletion polymorphism affecting its BH3-only activity-underlie cancer therapy resistance, autoimmune disorders, and neuronal apoptosis.

Loading...
||
New chat

Able

正在加载,请稍候...