Tested Applications
Positive WB detected in | Raji cells |
Positive IHC detected in | human ovary tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
25432-1-AP targets BIVM in WB, IHC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag22087 Product name: Recombinant human BIVM protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 411-503 aa of BC075084 Sequence: LHCIIAFQRLNWQRFGLWNFPFGTIRQESQPPTHAQGIAKSESEDNISKKQHGRLGRSFSASFHQDSAWKKMSSIHERRNSGYQGYSDYDGND Predict reactive species |
Full Name | basic, immunoglobulin-like variable motif containing |
Calculated Molecular Weight | 503 aa, 57 kDa |
Observed Molecular Weight | 32 kDa |
GenBank Accession Number | BC075084 |
Gene Symbol | BIVM |
Gene ID (NCBI) | 54841 |
RRID | AB_2880076 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q86UB2 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
BIVM has been identified using an electronic search based on the conservation of short sequence motifs within the variable region of immunoglobulin (Ig) genes. It is tightly linked (41 bp) and in the opposite transcriptional orientation to MGC5302 (also known as KDEL1 and EP58) in human. BIVM has two isoforms with MW 57 kDa and 32 kDa.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for BIVM antibody 25432-1-AP | Download protocol |
IHC protocol for BIVM antibody 25432-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |