Tested Applications
| Positive WB detected in | Jurkat cells, Raji cells, SH-SY5Y cells |
| Positive IP detected in | SH-SY5Y cells |
| Positive IHC detected in | human pancreas cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 2 publications below |
| IP | See 1 publications below |
Product Information
10510-1-AP targets BLK in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0795 Product name: Recombinant human BLK protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-100 aa of BC007371 Sequence: MGLVSSKKPDKEKPIKEKDKGQWSPLKVSAQDKDAPPLPPLVVFNHLTPPPPDEHLDEDKHFVVALYDYTAMNDRDLQMLKGEKLQVLKGTGDWWLARSL Predict reactive species |
| Full Name | B lymphoid tyrosine kinase |
| Calculated Molecular Weight | 58 kDa |
| Observed Molecular Weight | 58 kDa |
| GenBank Accession Number | BC007371 |
| Gene Symbol | BLK |
| Gene ID (NCBI) | 640 |
| RRID | AB_2274754 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P51451 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Tyrosine-protein kinase Blk(BLK) is typically involved in cell proliferation and differentiation.BLK is a 58 kDa protein with important role in B-cell receptor signaling and B-cell development. BLK also stimulates INS synthesis and secretion in response to glucose and enhances the expression of several pancreatic beta-cell transcription factors.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for BLK antibody 10510-1-AP | Download protocol |
| IP protocol for BLK antibody 10510-1-AP | Download protocol |
| WB protocol for BLK antibody 10510-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cancer Cell Molecular targets of glucocorticoids that elucidate their therapeutic efficacy in aggressive lymphomas | ||
Signal Transduct Target Ther B-lymphoid tyrosine kinase-mediated FAM83A phosphorylation elevates pancreatic tumorigenesis through interacting with β-catenin | ||
Diabet Med A novel BLK heterozygous mutation (p.Met121lle) in maturity-onset diabetes mellitus: A case report and literature review |













