BLNK Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• BLNK Recombinant monoclonal antibody (87170-3-RR)

• 

  WB analysis using 87170-3-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87170-3-RR (BLNK antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 87170-3-RR

  Sp2/0 cells were subjected to SDS PAGE followed by western blot with 87170-3-RR (BLNK antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  Affinity of 87170-3-RR

  Biolayer interferometry (BLl) kinetic assays of 87170-3-RR against Human LY86 were performed. The affinity constant is 1.13 nM.

BLNK Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 87170-3-RR

Clone No.252383A9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

BASH, B-cell adapter containing a SH2 domain protein, B-cell adapter containing a Src homology 2 domain protein, B-cell linker protein, Cytoplasmic adapter protein

---

Tested Applications

• Positive WB detected in: Raji cells, Sp2/0 cells, Ramos cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87170-3-RR targets BLNK in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg6610

  Product name: Recombinant Human BLNK protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 330-456 aa of NM_013314.4

  Sequence: SNSTISEQEAGVLCKPWYAGACDRKSAEEALHRSNKDGSFLIRKSSGHDSKQPYTLVVFFNKRVYNIPVRFIEATKQYALGRKKNGEEYFGSVAEIIRNHQHSPLVLIDSQNNTKDSTRLKYAVKVS

• Full Name: B-cell linker
• Calculated Molecular Weight: 50 kDa
• Observed Molecular Weight: 68-70 kDa
• GenBank Accession Number: NM_013314.4
• Gene Symbol: BLNK
• Gene ID (NCBI): 29760
• RRID: AB_3745385
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8WV28-1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

BLNK is a cytoplasmic linker or adaptor protein that plays a critical role in B cell development. This protein bridges B cell receptor-associated kinase activation with downstream signaling pathways, thereby affecting various biological functions. The phosphorylation of five tyrosine residues is necessary for this protein to nucleate distinct signaling effectors following B cell receptor activation. Mutations in this gene cause hypoglobulinemia and absent B cells, a disease in which the pro- to pre-B-cell transition is developmentally blocked. Deficiency in this protein has also been shown in some cases of pre-B acute lymphoblastic leukemia.