BLOC1S2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• BLOC1S2 Polyclonal antibody (12165-1-AP)

BLOC1S2 Polyclonal Antibody for WB, ELISA

Cat No. 12165-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

Biogenesis of lysosome-related organelles complex 1 subunit 2, BLOC 1 subunit 2, BLOC-1 subunit 2, BLOS2, CEAP

• 

  WB analysis using 12165-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12165-1-AP (BLOC1S2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12165-1-AP targets BLOC1S2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2807

  Product name: Recombinant human BLOC1S2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-99 aa of BC020494

  Sequence: MFSKMATYLTGELTATSEDYKLLENMNKLTSLKYLEMKDIAINISRNLKDLNQKYAGLQPYLDQINVIEEQVAALEQAAYKLDAYSKKLEAKYKKLEKR

• Full Name: biogenesis of lysosomal organelles complex-1, subunit 2
• Calculated Molecular Weight: 142 aa, 16 kDa
• Observed Molecular Weight: 17 kDa
• GenBank Accession Number: BC020494
• Gene Symbol: BLOC1S2
• Gene ID (NCBI): 282991
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6QNY1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

BLOS2, also named BLOC1S2, is a shared subunit of two lysosomal trafficking complexes, biogenesis of lysosome-related organelles complex-1 (BLOC-1) and BLOC-1 related complex. Loss of BLOS2 resulted in elevated Notch signaling which consequently increased the proliferation of neural progenitor cells and inhibited neuronal differentiation in cortices. BLOS2 is a novel negative player in regulating Notch signaling through lysosomal trafficking by controlling multiple stem and progenitor cell homeostasis in vertebrates. (PMID 27719760)