Product Information
12165-1-AP targets BLOC1S2 in ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2807 Product name: Recombinant human BLOC1S2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-99 aa of BC020494 Sequence: MFSKMATYLTGELTATSEDYKLLENMNKLTSLKYLEMKDIAINISRNLKDLNQKYAGLQPYLDQINVIEEQVAALEQAAYKLDAYSKKLEAKYKKLEKR Predict reactive species |
| Full Name | biogenesis of lysosomal organelles complex-1, subunit 2 |
| Calculated Molecular Weight | 142 aa, 16 kDa |
| GenBank Accession Number | BC020494 |
| Gene Symbol | BLOC1S2 |
| Gene ID (NCBI) | 282991 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q6QNY1 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
BLOS2, also named BLOC1S2, is a shared subunit of two lysosomal trafficking complexes, biogenesis of lysosome-related organelles complex-1 (BLOC-1) and BLOC-1 related complex. Loss of BLOS2 resulted in elevated Notch signaling which consequently increased the proliferation of neural progenitor cells and inhibited neuronal differentiation in cortices. BLOS2 is a novel negative player in regulating Notch signaling through lysosomal trafficking by controlling multiple stem and progenitor cell homeostasis in vertebrates. (PMID 27719760)
