BMPR1B Polyclonal antibody, PBS Only

• 

  WB analysis using 26696-1-AP (same clone as 26696-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 26696-1-AP (BMPR1B antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26696-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat ovary using 26696-1-AP (same clone as 26696-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat ovary tissue slide using 26696-1-AP (BMPR1B antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26696-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat ovary using 26696-1-AP (same clone as 26696-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat ovary tissue slide using 26696-1-AP (BMPR1B antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26696-1-PBS in a different storage buffer formulation.

• 

  IF Staining of MCF-7 using 26696-1-AP (same clone as 26696-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed MCF-7 cells using BMPR1B antibody (26696-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 26696-1-PBS in a different storage buffer formulation.

BMPR1B Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 26696-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

BMP type 1B receptor, BMP type-1B receptor, BMPR 1B, BMPR-1B, Bone morphogenetic protein receptor type-1B

---

Product Information

26696-1-PBS targets BMPR1B in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24902

  Product name: Recombinant human BMPR1B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 16-57 aa of BC047773

  Sequence: EDGESTAPTPRPKVLRCKCHHHCPEDSVNNICSTDGYCFTMI

• Full Name: bone morphogenetic protein receptor, type IB
• Calculated Molecular Weight: 57 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC047773
• Gene Symbol: BMPR1B
• Gene ID (NCBI): 658
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O00238
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

BMPR1B (Bone morphogenetic protein receptor type-1B) is also named as CDw293. BMPR1B belongs to the protein kinase superfamily. BMPR1B is on ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. BMPR1B is receptor for BMP7/OP-1 and GDF5. BMPR1B Positively regulates chondrocyte differentiation through GDF5 interaction.