Product Information
83029-8-PBS targets BMPR1B as part of a matched antibody pair:
MP00108-4: 83029-4-PBS capture and 83029-8-PBS detection (validated in Sandwich ELISA)
Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Ag24902 Product name: Recombinant human BMPR1B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 16-57 aa of BC047773 Sequence: EDGESTAPTPRPKVLRCKCHHHCPEDSVNNICSTDGYCFTMI Predict reactive species |
Full Name | bone morphogenetic protein receptor, type IB |
Calculated Molecular Weight | 57 kDa |
GenBank Accession Number | BC047773 |
Gene Symbol | BMPR1B |
Gene ID (NCBI) | 658 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | O00238 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |