BMPR2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• BMPR2 Polyclonal antibody, PBS Only (19087-1-PBS)

• 

  WB analysis of human heart using 19087-1-AP (same clone as 19087-1-PBS)

  human heart tissue were subjected to SDS PAGE followed by western blot with 19087-1-AP (BMPR2 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 19087-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 19087-1-AP (same clone as 19087-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 19087-1-AP (BMPR2 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 19087-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse brain using 19087-1-AP (same clone as 19087-1-PBS)

  IP result of anti-BMPR2 (IP:19087-1-AP, 4ug; Detection:19087-1-AP 1:1500) with mouse brain tissue lysate 4000ug. This data was developed using the same antibody clone with 19087-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 19087-1-AP (same clone as 19087-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 19087-1-AP (BMPR2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 19087-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 19087-1-AP (same clone as 19087-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 19087-1-AP (BMPR2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 19087-1-PBS in a different storage buffer formulation.

• 

  FC experiment of PC-3 using 19087-1-AP (same clone as 19087-1-PBS)

  1x10^6 PC-3 cells were intracellularly stained with 0.4 ug BMPR2 Polyclonal antibody (19087-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.4 ug Rabbit IgG control Rabbit PolyAb (30000-0-AP) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 19087-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

BMPR2 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 19087-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

BMPR-2, BMPR II, BMPR 2, BMP type-2 receptor, BMP type II receptor

---

Product Information

19087-1-PBS targets BMPR2 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5868

  Product name: Recombinant human BMPR2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 172-504 aa of BC052985

  Sequence: YRMLTGDRKQGLHSMNMMEAAASEPSLDLDNLKLLELIGRGRYGAVYKGSLDERPVAVKVFSFANRQNFINEKNIYRVPLMEHDNIARFIVGDERVTADGRMEYLLVMEYYPNGSLCKYLSLHTSDWVSSCRLAHSVTRGLAYLHTELPRGDHYKPAISHRDLNSRNVLVKNDGTCVISDFGLSMRLTGNRLVRPGEEDNAAISEVGTIRYMAPEVLEGAVNLRDCESALKQVDMYALGLIYWEIFMRCTDLFPGESVPEYQMAFQTEVGNHPTFEDMQVLVSREKQRPKFPEAWKENSLAVRSLKETIEDCWDQDAEARLTAQCAEERMAEL

• Full Name: bone morphogenetic protein receptor, type II (serine/threonine kinase)
• Calculated Molecular Weight: 115 kDa
• Observed Molecular Weight: 120 kDa
• GenBank Accession Number: BC052985
• Gene Symbol: BMPR2
• Gene ID (NCBI): 659
• RRID: AB_10603355
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13873
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

BMPs (bone morphogenetic protein) are involved in endochondral bone formation and embryogenesis. BMPR2 encodes a member of the (BMP) receptor family of transmembrane serine/threonine kinases. It is a widely expressed receptor, with high mRNA expression during development in many tissues. The dimer of BMPR2 receptors (70-80 kD) forms a complex with a dimer of type I BMPR1(50-55 kD) in signal transduction. This antibody recognizes endogenous levels of total BMPR2 protein, including 115 kD precursor, 75 kD mature form, and 150 kD dimer.