BNIP3L Monoclonal antibody, PBS Only

BNIP3L Monoclonal Antibody for WB, IHC, Indirect ELISA
Cat No. 68118-1-PBS
Clone No.1F6A3

Host / Isotype

Mouse / IgG1

Reactivity

human, rat

Applications

WB, IHC, Indirect ELISA

1F6A3, Adenovirus E1B19K-binding protein B5, BCL2/adenovirus E1B 19 kDa protein-interacting protein 3A, BNIP3A, BNIP3H

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68118-1-PBS targets BNIP3L in WB, IHC, Indirect ELISA applications and shows reactivity with human, rat samples.

Tested Reactivity human, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag31547

Product name: Recombinant human BNIP3L protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 77-146 aa of BC001559

Sequence: DAQHESGQSSSRGSSHCDSPSPQEDGQIMFDVEMHTSRDHSSQSEEEVVEGEKEVEALKKSADWVSDWSS

Predict reactive species
Full Name BCL2/adenovirus E1B 19kDa interacting protein 3-like
Calculated Molecular Weight 24 kDa
Observed Molecular Weight35 kD
GenBank Accession NumberBC001559
Gene Symbol BNIP3L
Gene ID (NCBI) 665
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDO60238
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

BNIP3L/Nix is a mitochondrial protein from the outer membrane that belongs to the BH3-only protein from the BCL2 family. BNIP3L was initially recognized as a proapoptotic protein with milder efficacy in inducing apoptosis compared to other proteins in this family. These phenotypes raised concerns about the molecular function of BNIP3L besides inducing apoptosis. Moreover, studies have shown that BNIP3L is a 24-kDa protein, which is predominantly expressed as a 48-kDa dimer. When analyzed by SDS-PAGE, BNIP3 migrates predominantly as a about 60 kDa dimer in addition to the 30 kDa monomer. (PMID: 34930907, PMID: 32286918)

Loading...
||
New chat Able
正在加载,请稍候...