Product Information
68118-1-PBS targets BNIP3L in WB, IHC, Indirect ELISA applications and shows reactivity with human, rat samples.
| Tested Reactivity | human, rat |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag31547 Product name: Recombinant human BNIP3L protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 77-146 aa of BC001559 Sequence: DAQHESGQSSSRGSSHCDSPSPQEDGQIMFDVEMHTSRDHSSQSEEEVVEGEKEVEALKKSADWVSDWSS Predict reactive species |
| Full Name | BCL2/adenovirus E1B 19kDa interacting protein 3-like |
| Calculated Molecular Weight | 24 kDa |
| Observed Molecular Weight | 35 kD |
| GenBank Accession Number | BC001559 |
| Gene Symbol | BNIP3L |
| Gene ID (NCBI) | 665 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | O60238 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
BNIP3L/Nix is a mitochondrial protein from the outer membrane that belongs to the BH3-only protein from the BCL2 family. BNIP3L was initially recognized as a proapoptotic protein with milder efficacy in inducing apoptosis compared to other proteins in this family. These phenotypes raised concerns about the molecular function of BNIP3L besides inducing apoptosis. Moreover, studies have shown that BNIP3L is a 24-kDa protein, which is predominantly expressed as a 48-kDa dimer. When analyzed by SDS-PAGE, BNIP3 migrates predominantly as a about 60 kDa dimer in addition to the 30 kDa monomer. (PMID: 34930907, PMID: 32286918)















