BOP1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 82742-3-RR (same clone as 82742-3-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 82742-3-RR (BOP1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 82742-3-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 82742-3-RR (same clone as 82742-3-PBS)

  WB result of BOP1 antibody (82742-3-RR; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-BOP1 transfected HeLa cells. This data was developed using the same antibody clone with 82742-3-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovarian cancer using 82742-3-RR (same clone as 82742-3-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovarian cancer slide using 82742-3-RR (BOP1 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 82742-3-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovarian cancer using 82742-3-RR (same clone as 82742-3-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovarian cancer slide using 82742-3-RR (BOP1 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 82742-3-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 82742-3-RR (same clone as 82742-3-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using BOP1 antibody (82742-3-RR, Clone: 3A4 ) at dilution of 1:1000 and Multi-rAb CoraLite ® Plus 594-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR004). This data was developed using the same antibody clone with 82742-3-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 82742-3-RR (same clone as 82742-3-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using BOP1 antibody (82742-3-RR, Clone: 3A4 ) at dilution of 1:1000 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), Alpha Tubulin antibody (66031-1-Ig, Clone: 1E4C11, red). This data was developed using the same antibody clone with 82742-3-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

BOP1 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 82742-3-PBS

Clone No.3A4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

KIAA0124, block of proliferation 1, 3A4

---

Product Information

82742-3-PBS targets BOP1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag26669

  Product name: Recombinant human BOP1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-135 aa of BC013787

  Sequence: MAGSRGAGRTAAPSVRPEKRRSEPELEPEPEPEPPLLCTSPLSHSTGSDSGVSDSEESVFSGLEDSGSDSSEDDDEGDEEGEDGALDDEGHSGIKKTTEEQVQASTPCPRTEMASARIGDEYAEDSSDEEDIRNT

• Full Name: block of proliferation 1
• Calculated Molecular Weight: 84 kDa
• Observed Molecular Weight: 117 kDa
• GenBank Accession Number: BC013787
• Gene Symbol: BOP1
• Gene ID (NCBI): 23246
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q14137
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Block of Proliferation 1(BOP1) protein was first isolated from a mouse, and the truncation protein may led to cell cycle arrest. Bop1 plays a role in processing of the 28S and 5.8S rRNAs (ribosomal RNAs) to regulate ribosome biogenesis. And Bop1 also act as a component of Pes1/Bop1/WDR21 (PeBoW) complex for mature 60S ribosome, and consequently acts during cell division at G1 checkpoints (PMID:18670790; PMID:26940494). What's more, abnormal expression of BOP1 was associated with liver or colorectal cancers (PMID:16804918). The molecular weight of the protein we detected was slightly higher, about 117 kd, which is also seen in the article (PMID: 30100995).