BPHL Polyclonal antibody, PBS Only

• 

  WB analysis of human kidney using 17974-1-AP (same clone as 17974-1-PBS)

  human kidney tissue were subjected to SDS PAGE followed by western blot with 17974-1-AP (BPHL antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17974-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human liver using 17974-1-AP (same clone as 17974-1-PBS)

  human liver tissue were subjected to SDS PAGE followed by western blot with 17974-1-AP (BPHL antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17974-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 17974-1-AP (same clone as 17974-1-PBS)

  MCF7 cells were subjected to SDS PAGE followed by western blot with 17974-1-AP (BPHL antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17974-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse kidney using 17974-1-AP (same clone as 17974-1-PBS)

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 17974-1-AP (BPHL Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17974-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse kidney using 17974-1-AP (same clone as 17974-1-PBS)

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 17974-1-AP (BPHL Antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17974-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 17974-1-AP (same clone as 17974-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney using 17974-1-AP (BPHL antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 17974-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 17974-1-AP (same clone as 17974-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney using 17974-1-AP (BPHL antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 17974-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 17974-1-AP (same clone as 17974-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta using 17974-1-AP (BPHL antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 17974-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 17974-1-AP (same clone as 17974-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta using 17974-1-AP (BPHL antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 17974-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung using 17974-1-AP (same clone as 17974-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung using 17974-1-AP (BPHL antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 17974-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung using 17974-1-AP (same clone as 17974-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung using 17974-1-AP (BPHL antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 17974-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary using 17974-1-AP (same clone as 17974-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary using 17974-1-AP (BPHL antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 17974-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary using 17974-1-AP (same clone as 17974-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary using 17974-1-AP (BPHL antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 17974-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 17974-1-AP (same clone as 17974-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart using 17974-1-AP (BPHL antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 17974-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 17974-1-AP (same clone as 17974-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart using 17974-1-AP (BPHL antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 17974-1-PBS in a different storage buffer formulation.

BPHL Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 17974-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

17974-1-PBS targets BPHL in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12085

  Product name: Recombinant human BPHL protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-194 aa of BC037778

  Sequence: MPRNLLYSLLSSHLSPHFSTSVTSAKVAVNGVQLHYQQTGEGDHAVLLLPGMLGSGETDFGPQLKNLNKKLFTVVAWDPRGYGHSRPPDRDFPADFFERDAKDAVDLMKALKFKKVSLLGWSDGGITALIAAAKYPSYIHKMVIWGANAYVTDEDSMIYEGIRDVSKWSERTRKPLEALYGWSLTLSPGWNAMA

• Full Name: biphenyl hydrolase-like (serine hydrolase)
• Calculated Molecular Weight: 22 kDa, 32 kDa
• Observed Molecular Weight: 27 kDa
• GenBank Accession Number: BC037778
• Gene Symbol: BPHL
• Gene ID (NCBI): 670
• RRID: AB_2274994
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86WA6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.