BPIFA2 Polyclonal antibody

• 

  WB analysis using 28293-1-AP

  human saliva tissue were subjected to SDS PAGE followed by western blot with 28293-1-AP (BPIFA2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

BPIFA2 Polyclonal Antibody for WB, ELISA

Cat No. 28293-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human

Applications

WB, ELISA

Synonyms

bA49G10.1, BPIFA2, C20orf70, Parotid secretory protein, PSP, SPLUNC2

---

Tested Applications

• Positive WB detected in: human saliva

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28293-1-AP targets BPIFA2 in WB, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27401

  Product name: Recombinant human C20orf70 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 15-123 aa of BC065726

  Sequence: TGTSESLLDNLGNDLSNVVDKLEPVLHEGLETVDNTLKGILEKLKVDLGVLQKSSAWQLAKQKAQEAEKLLNNVISKLLPTNTDIFGLKISNSLILDVKAEPIDDGKGL

• Full Name: chromosome 20 open reading frame 70
• Calculated Molecular Weight: 249 aa, 27 kDa
• Observed Molecular Weight: 30-37 kDa
• GenBank Accession Number: BC065726
• Gene Symbol: BPIFA2
• Gene ID (NCBI): 140683
• RRID: AB_2881107
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96DR5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.