BRD2 Recombinant monoclonal antibody, PBS Only

BRD2 Uni-rAb® Recombinant Antibody for WB, IF/ICC, IP, Indirect ELISA
Cat No. 85990-2-PBS
Clone No.250453G5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, IP, Indirect ELISA

bromodomain containing 2, Bromodomain-containing protein 2, D6S113E, FSH, FSRG1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85990-2-PBS targets BRD2 in WB, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag17589

Product name: Recombinant human BRD2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 537-668 aa of BC063840

Sequence: LSQGPISKPKRKREKKEKKKKRKAEKHRGRAGADEDDKGPRAPRPPQPKKSKKASGSGGGSAALGPSGFGPSGGSGTKLQAGVQWRDLGLLQPPLLGFKRFSCLSLPSSQDYRLPKKATKTAPPALPTGYDS

Predict reactive species
Full Name bromodomain containing 2
Calculated Molecular Weight 836 aa, 92 kDa
Observed Molecular Weight 100-110 kDa
GenBank Accession NumberBC063840
Gene Symbol BRD2
Gene ID (NCBI) 6046
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP25440
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

BRD2 (Bromodomain-containing protein 2), also known as RING3, is a member of the Bromodomain and Extra-Terminal (BET) family of proteins. These proteins contain two bromodomains and one extra-terminal domain. BRD2 primarily localizes to the nucleus and functions as an atypical protein kinase. Its main role involves the activation of E2F1 and E2F2 proteins, facilitating the production of proteins essential for the G1/S phase transition of the cell cycle. BRD2 specifically recognizes acetylated histones through its bromodomains, particularly acetylated lysine residues on histones H3 and H4. This interaction allows BRD2 to recruit various transcription factors, co-activators, and repressors, thereby modulating transcriptional activity. BRD2 plays a crucial role in chromatin remodeling by recruiting proteins such as histone deacetylases. It is highly expressed during neural tube development and closure, making it essential for neurogenesis and embryogenesis.(PMID: 33462181, PMID: 37926722)

Loading...
||
New chat Able
正在加载,请稍候...