BRD2 Recombinant monoclonal antibody

BRD2 Uni-rAb® Recombinant Antibody for WB, IF/ICC, IP, ELISA
Cat No. 85990-2-RR
Clone No.250453G5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, IP, ELISA

bromodomain containing 2, Bromodomain-containing protein 2, D6S113E, FSH, FSRG1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, Jurkat cells, A549 cells, K-562 cells, C2C12 cells, PC-12 cells
Positive IP detected inHeLa cells
Positive IF/ICC detected inJurkat cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunofluorescence (IF)/ICCIF/ICC : 1:250-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

85990-2-RR targets BRD2 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag17589

Product name: Recombinant human BRD2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 537-668 aa of BC063840

Sequence: LSQGPISKPKRKREKKEKKKKRKAEKHRGRAGADEDDKGPRAPRPPQPKKSKKASGSGGGSAALGPSGFGPSGGSGTKLQAGVQWRDLGLLQPPLLGFKRFSCLSLPSSQDYRLPKKATKTAPPALPTGYDS

Predict reactive species
Full Name bromodomain containing 2
Calculated Molecular Weight 836 aa, 92 kDa
Observed Molecular Weight 100-110 kDa
GenBank Accession NumberBC063840
Gene Symbol BRD2
Gene ID (NCBI) 6046
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP25440
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

BRD2 (Bromodomain-containing protein 2), also known as RING3, is a member of the Bromodomain and Extra-Terminal (BET) family of proteins. These proteins contain two bromodomains and one extra-terminal domain. BRD2 primarily localizes to the nucleus and functions as an atypical protein kinase. Its main role involves the activation of E2F1 and E2F2 proteins, facilitating the production of proteins essential for the G1/S phase transition of the cell cycle. BRD2 specifically recognizes acetylated histones through its bromodomains, particularly acetylated lysine residues on histones H3 and H4. This interaction allows BRD2 to recruit various transcription factors, co-activators, and repressors, thereby modulating transcriptional activity. BRD2 plays a crucial role in chromatin remodeling by recruiting proteins such as histone deacetylases. It is highly expressed during neural tube development and closure, making it essential for neurogenesis and embryogenesis.(PMID: 33462181, PMID: 37926722)

Protocols

Product Specific Protocols
IF protocol for BRD2 antibody 85990-2-RRDownload protocol
IHC protocol for BRD2 antibody 85990-2-RRDownload protocol
IP protocol for BRD2 antibody 85990-2-RRDownload protocol
WB protocol for BRD2 antibody 85990-2-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...