BRF2 Polyclonal antibody, PBS Only

BRF2 Polyclonal Antibody for WB, Indirect ELISA
Cat No. 12056-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

12056-1-PBS targets BRF2 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2686

Product name: Recombinant human BRF2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 120-419 aa of BC010648

Sequence: CCVLITCRQHNWPLTMGAICTLLYADLDVFSSTYMQIVKLLGLDVPSLCLAELVKTYCSSFKLFQASPSVPAKYVEDKEKMLSRTMQLVELANETWLVTGRHPLPVITAATFLAWQSLQPADRLSCSLARFCKLANVDLPYPASSRLQELLAVLLRMAEQLAWLRVLRLDKRSVVKHIGDLLQHRQSLVRSAFRDGTAEVETREKEPPGWGQGQGEGEVGNNSLGLPQGKRPASPALLLPPCMLKSPKRICPVPPVSTVTGDENISDSEIEQYLRTPQEVRDFQRAQAARQAATSVPNPP

Predict reactive species
Full Name BRF2, subunit of RNA polymerase III transcription initiation factor, BRF1-like
Calculated Molecular Weight 47 kDa
Observed Molecular Weight 50-60 kDa
GenBank Accession NumberBC010648
Gene Symbol BRF2
Gene ID (NCBI) 55290
RRIDAB_2218683
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9HAW0
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Human cells contain two types of RNA polymerase III transcription factor(TFIIIB), BRF1 and BRF2. BRF2,also named as BRFU, contains one TFIIB-type zinc finger. It is a general activator of RNA polymerase III transcription. It is a factor exclusively required for RNA polymerase III transcription of genes with promoter elements upstream of the initiation sites. BRF2 is recruited to type 3 promoters such as the human U6 snRNA promoter. It differs from BRF1-TFIIIB in that it contains the TFIIB-related factor BRF2 iinstead of BRF1 and its three components do not form a stable complex. This antibody is a rabbit polyclonal antibody raised against residues near the C terminus of human BRF2. It recognizes a 50-60kd band in WB analysis.

Loading...
||
New chat Able
正在加载,请稍候...