BRF2 Polyclonal antibody

• 

  WB analysis of HT-1080 using 12056-1-AP

  HT-1080 cells were subjected to SDS PAGE followed by western blot with 12056-1-AP (BRF2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of DU 145 using 12056-1-AP

  DU 145 cells were subjected to SDS PAGE followed by western blot with 12056-1-AP (BRF2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

BRF2 Polyclonal Antibody for WB, ELISA

Cat No. 12056-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

B related factor 2, BRF 2, BRF2, BRFU, hBRFU, hTFIIIB50, TFIIIB50

---

Tested Applications

• Positive WB detected in: HT-1080 cells, DU 145 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

12056-1-AP targets BRF2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2686

  Product name: Recombinant human BRF2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 120-419 aa of BC010648

  Sequence: CCVLITCRQHNWPLTMGAICTLLYADLDVFSSTYMQIVKLLGLDVPSLCLAELVKTYCSSFKLFQASPSVPAKYVEDKEKMLSRTMQLVELANETWLVTGRHPLPVITAATFLAWQSLQPADRLSCSLARFCKLANVDLPYPASSRLQELLAVLLRMAEQLAWLRVLRLDKRSVVKHIGDLLQHRQSLVRSAFRDGTAEVETREKEPPGWGQGQGEGEVGNNSLGLPQGKRPASPALLLPPCMLKSPKRICPVPPVSTVTGDENISDSEIEQYLRTPQEVRDFQRAQAARQAATSVPNPP

• Full Name: BRF2, subunit of RNA polymerase III transcription initiation factor, BRF1-like
• Calculated Molecular Weight: 47 kDa
• Observed Molecular Weight: 50-60 kDa
• GenBank Accession Number: BC010648
• Gene Symbol: BRF2
• Gene ID (NCBI): 55290
• RRID: AB_2218683
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9HAW0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Human cells contain two types of RNA polymerase III transcription factor(TFIIIB), BRF1 and BRF2. BRF2,also named as BRFU, contains one TFIIB-type zinc finger. It is a general activator of RNA polymerase III transcription. It is a factor exclusively required for RNA polymerase III transcription of genes with promoter elements upstream of the initiation sites.BRF2 is recruited to type 3 promoters such as the human U6 snRNA promoter. It differs from BRF1-TFIIIB in that it contains the TFIIB-related factor BRF2 iinstead of BRF1 and its three components do not form a stable complex. This antibody is a rabbit polyclonal antibody raised against residues near the C terminus of human BRF2. It recognizes a 50-60kd band in WB analysis.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Commun; Structural basis of human SNAPc recognizing proximal sequence element of snRNA promoter; Authors - Jianfeng Sun