Tested Applications
| Positive WB detected in | HeLa cells |
| Positive IF-P detected in | mouse eye tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
30118-1-AP targets BST2 in WB, IF-P, ELISA applications and shows reactivity with Human, mouse samples.
| Tested Reactivity | Human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag32333 Product name: Recombinant human BST2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 49-161 aa of BC033873 Sequence: NSEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDSS Predict reactive species |
| Full Name | bone marrow stromal cell antigen 2 |
| Calculated Molecular Weight | 180 aa, 20 kDa |
| Observed Molecular Weight | 30-36 kDa, 50-70 kDa |
| GenBank Accession Number | BC033873 |
| Gene Symbol | BST2 |
| Gene ID (NCBI) | 684 |
| RRID | AB_3086236 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q10589 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
BST2, also named as CD317 and Tetherin, belongs to the tetherin family. It may be involved in the sorting of secreted proteins and it is involved in pre-B-cell growth. BST2 is an antiretroviral defense protein, that blocks release of retrovirus from the cell surface. Depleted unpon HIV-1 infection by viral VPU protein through 20S proteasome degradation. Depleted upon infection by human Kaposi's sarcoma-associated herpesvirus (KSHV) through ubiquitination and subsequent degradation. BST2 may play a role in B-cell activation in rheumatoid arthritis. It is recently identified interferon-induced cellular proteins that restrict infections by retroviruses and filoviruses and of influenza virus and flaviviruses, respectively. BST2 is a plasma membrane proteins, tetherin inhibits virion particle release from infected cells. BST2 is effective against retroviruses and flavoviruses whilst IFITMs disrupt influenza and flavivirus infection. Observed MW of BST2 is 30-36 kDa (PMID: 19196977; 21237475).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for BST2 antibody 30118-1-AP | Download protocol |
| WB protocol for BST2 antibody 30118-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |







