BTN1A1 Polyclonal antibody

• 

  WB analysis of Caco-2 using 26687-1-AP

  Caco-2 cells were subjected to SDS PAGE followed by western blot with 26687-1-AP (BTN1A1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

BTN1A1 Polyclonal Antibody for WB, ELISA

Cat No. 26687-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, ELISA

Synonyms

BT, BTN, BTN1A1

---

Tested Applications

• Positive WB detected in: Caco-2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

26687-1-AP targets BTN1A1 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24613

  Product name: Recombinant human BTN1A1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 448-526 aa of BC096312

  Sequence: SNVTFSGPLRPFFCLWSSGKKPLTICPIADGPERVTVIANAQDLSKEIPLSPMGEDSAPRDADTLHSKLIPTQPSQGAP

• Full Name: butyrophilin, subfamily 1, member A1
• Calculated Molecular Weight: 526 aa, 59 kDa
• Observed Molecular Weight: 65-75 kDa
• GenBank Accession Number: BC096312
• Gene Symbol: BTN1A1
• Gene ID (NCBI): 696
• RRID: AB_2880603
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13410
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

BTN1A1, also named as Butyrophilin subfamily 1 member A1, is a 526 amino acid protein, which contains 1 B30.2/SPRY domain and belongs to the immunoglobulin superfamily. BTN/MOG family. BTN1A1 localizes in the integral component of plasma membrane. BTN1A1 may function in the secretion of milk-fat droplets and may act as a specific membrane-associated receptor for the association of cytoplasmic droplets with the apical plasma membrane. BTN1A1 Inhibits the proliferation of CD4 and CD8 T-cells activated by anti-CD3 antibodies, T-cell metabolism and IL2 and IFNG secretion. The calculated molecular weight of BTN1A1 is a 59 kDa, but the modified BTN1A1 protein is about 65-75 kDa.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Biochem Biophys Res Commun; Simple methods for measuring milk exosomes using fluorescent compound GIF-2250/2276; Authors - Saho Furukawa