BUD31 Polyclonal antibody

• 

  WB analysis of mouse brain using 11798-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 11798-1-AP (BUD31 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of hESC using 11798-1-AP

  hESC cells were subjected to SDS PAGE followed by western blot with 11798-1-AP (BUD31 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 11798-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 11798-1-AP (BUD31 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse heart using 11798-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 11798-1-AP (BUD31 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Raji using 11798-1-AP

  Raji cells were subjected to SDS PAGE followed by western blot with 11798-1-AP (BUD31 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse lung using 11798-1-AP

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 11798-1-AP (BUD31 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse liver using 11798-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 11798-1-AP (BUD31 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 11798-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 11798-1-AP (BUD31 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse brain using 11798-1-AP

  IP result of anti-BUD31 (IP:11798-1-AP, 4ug; Detection:11798-1-AP 1:1500) with mouse brain tissue lysate 3440ug.

• 

  IHC staining of human colon cancer using 11798-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer using 11798-1-AP (BUD31 antibody) at dilution of 1:100 (under 10x lens).

• Featured Product
• KD/KO Validated

BUD31 Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 11798-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, CoIP, RIP, ELISA

Synonyms

BUD31, BUD31 homolog (S. cerevisiae), EDG 2, EDG2, fSAP17, G10, Protein BUD31 homolog, Protein EDG 2, Protein G10 homolog, YCR063W

---

Tested Applications

• Positive WB detected in: mouse brain tissue, hESC cells, human brain tissue, Jurkat cells, mouse heart tissue, mouse liver tissue, mouse lung tissue, Raji cells
• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 4 publications below
• WB: See 4 publications below
• IHC: See 1 publications below
• IF: See 1 publications below
• CoIP: See 1 publications below
• RIP: See 2 publications below

Product Information

11798-1-AP targets BUD31 in WB, IHC, IF, IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2373

  Product name: Recombinant human BUD31 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-144 aa of BC022821

  Sequence: MPKVKRSRKAPPDGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIFRIHHQKTRYIFDLFYKRKAISRELYEYCIKEGYADKNLIAKWKKQGYENLCCLRCIQTRDTNFGTNCICRVPKSKLEVGRIIECTHCGCRGCSG

• Full Name: BUD31 homolog (S. cerevisiae)
• Calculated Molecular Weight: 144 aa, 17 kDa
• Observed Molecular Weight: 17-20 kDa
• GenBank Accession Number: BC022821
• Gene Symbol: BUD31
• Gene ID (NCBI): 8896
• RRID: AB_2274894
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P41223
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nature; The spliceosome is a therapeutic vulnerability in MYC-driven cancer.; Authors - Tiffany Y-T Hsu ; KD Validated
human	WB	iScience; Multi-omics approach reveals posttranscriptionally regulated genes are essential for human pluripotent stem cells.; Authors - Mio Iwasaki
mouse	WB,RIP	Cell Death Differ; Bud31-mediated alternative splicing is required for spermatogonial stem cell self-renewal and differentiation; Authors - Junchao Qin ; KD Validated
human	IHC,IF,CoIP,RIP	Nat Commun; Splicing factor BUD31 promotes ovarian cancer progression through sustaining the expression of anti-apoptotic BCL2L12; Authors - Zixiang Wang ; KD Validated
human	WB	Clin Exp Med; The role of BUD31 in clear cell renal cell carcinoma: prognostic significance, alternative splicing, and tumor immune environment; Authors - Xiaoliang Wu ; KD Validated