Tested Applications
| Positive WB detected in | mouse skeletal muscle tissue |
| Positive IHC detected in | human ovary tumor tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
| IHC | See 1 publications below |
Product Information
12920-1-AP targets BVES in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3593 Product name: Recombinant human BVES protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 112-360 aa of BC034425 Sequence: LYKKRPVKIEKELSGMYRRLFEPLRVPPDLFRRLTGQFCMIQTLKKGQTYAAEDKTSVDDRLSILLKGKMKVSYRGHFLHNIYPCAFIDSPEFRSTQMHKGEKFQVTIIADDNCRFLCWSRERLTYFLESEPFLYEIFRYLIGKDITNKLYSLNDPTLNDKKAKKLEHQLSLCTQISMLEMRNSIASSSDSDDGLHQFLRGTSSMSSLHVSSPHQRASAKMKPIEEGAEDDDDVFEPASPNTLKVHQLP Predict reactive species |
| Full Name | blood vessel epicardial substance |
| Calculated Molecular Weight | 360 aa, 41 kDa |
| Observed Molecular Weight | 41-70 kDa |
| GenBank Accession Number | BC034425 |
| Gene Symbol | BVES |
| Gene ID (NCBI) | 11149 |
| RRID | AB_10640584 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8NE79 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
BVES, also named as POP1, POPDC1 and hBVES, belongs to the popeye family. It is cell adhesion molecule involved in the establishment and/or maintenance of cell integrity. It is involved in the formation and regulation of the tight junction (TJ) paracellular permeability barrier in epithelial cells. It is also involved in striated muscle regeneration and repair and in the regulation of cell spreading. BVES is expressed in the progenitors of coronary artery smooth muscle cells as well as in differentiated smooth muscle cells.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for BVES antibody 12920-1-AP | Download protocol |
| WB protocol for BVES antibody 12920-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Oncol Rep MBNL1‑AS1 attenuates tumor cell proliferation by regulating the miR‑29c‑3p/BVES signal in colorectal cancer | ||
Pathol Oncol Res Abnormal expression of adhesion protein Bves is associated with gastric cancer progression and poor survival. |





